KEGG   Trametes versicolor: TRAVEDRAFT_166655Help
Entry
TRAVEDRAFT_166655 CDS       T04795                                 

Definition
(RefSeq) Arginase/deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
tvs  Trametes versicolor
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tvs03036]
    TRAVEDRAFT_166655
Enzymes [BR:tvs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TRAVEDRAFT_166655
Chromosome and associated proteins [BR:tvs03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     TRAVEDRAFT_166655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl PMBR
Motif
Other DBs
NCBI-GeneID: 19410850
NCBI-ProteinID: XP_008037719
JGI: 166655
LinkDB All DBs
Position
Unknown
AA seq 590 aa AA seqDB search
MPQTSVFLQKACLQHRYIRTRDNSHIVERPERLRAVNIGLAATVARLEEVAPPTSETRAT
GSTATDEDADELTKALGKLQLEAPSRLDHSARVPVAFVQSDASADLLSHPAVKFVHGDIE
RDVYLEALTAMAKDSQDKVNKGESEIPEGYSQGDLYLSPGSLDAIQGALGTVCEAVDAVL
QASQATSGSSADSRQPSQAFVAVRPPGHHCGEDTPSGFCFVNNVAVGAAHAHLKHNINRV
IIFDIDLHHGNGTQAIAWGINEETYRKQLEAEQGAPADKPGLQVYYGSIHDILSYPCEDG
KAELIQAASVSIHGPHGQHVENIHLQPYASEQEFWDKLYPTQYLRLLKKAGEFIESTGGM
RDDTLVFISCGFDACEHEYPSMSRHQRKVPASFYHRFARDARAFAEQYAQGRLISVLEGG
YSDRALTSGAMAHLAGLVDTGNIGVDEKWWSLENLTALEAATKKRRGGRPSNTAPPEPWL
ARTVELFASIDSSHTVPVVPRAPIPPSNRTLRDRKPQSAASTASAKASPATSPGKKGVAK
NVERTKKSTSGSESDLTDITSGSGSEKAGGESASKKLPRVILKLGPAPGV
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgccccagacttctgtttttctacagaaagcgtgcctacagcatcgctatattcgaacg
cgcgacaattcacacatcgttgagcggccggaaaggctgcgtgcggtgaacattgggctc
gcggccacagtcgcgcggcttgaagaggtcgcgcctccaacatccgaaacccgcgcgaca
ggatccaccgctacggatgaggacgcggacgagttgacaaaggccctcggaaagctgcag
ctcgaggcaccctcgcgactcgaccattctgcccgggtacccgttgcgtttgttcagagc
gatgcttccgcggatctcctcagccacccggcggtcaaattcgtgcacggagatatagaa
cgcgacgtttatctcgaggcactcacggcgatggcgaaggatagccaagacaaagtcaat
aaaggagaaagcgaaatccccgagggctactcacagggcgacctctacttgtcaccaggg
tcactagacgctatacagggtgctcttgggactgtatgcgaagcagtcgacgcggttctt
caggcgtcccaggcgacctcgggctcctctgccgattcgcgacaacccagtcaagcattt
gttgcggtccgcccaccagggcaccactgcggagaggatacgccttcaggcttctgtttt
gtgaataacgtcgcagtcggagcagcgcacgctcacctgaagcacaacatcaaccgcgta
atcatcttcgacatcgatctacatcatgggaacggcacgcaagctatcgcatggggaatc
aacgaagagacctaccgtaaacagctcgaagccgagcagggcgcacccgccgacaaacca
ggtcttcaagtctactacggtagcatacacgatatcctctcttacccgtgcgaggacggg
aaagcggagctcatccaagccgcttccgtgtccatccatggtccgcatgggcaacatgtg
gagaacattcacctccagccgtacgcgtctgagcaggagttctgggataagttgtacccc
acgcagtacctgcgcctattgaagaaggccggggagttcatcgaaagcacgggcgggatg
cgtgacgacaccctggtctttatcagttgcggcttcgatgcatgcgaacacgagtaccct
tcgatgtcgcgccaccagcggaaggtgcccgcgtcgttctaccaccgcttcgcccgagac
gcgcgcgcgttcgcagagcagtacgcgcagggccggctcatcagcgttctagaaggaggc
tacagcgaccgtgcactcacgagcggcgccatggcacacctcgctggccttgtcgacacc
ggaaacattggcgtagacgagaagtggtggagtctcgagaaccttactgcacttgaggct
gcaacgaagaagcgcagaggcgggcgaccgtccaacaccgccccacctgaaccgtggctc
gcgcgcacggtggagcttttcgcgtcgatcgactcgtcgcacacggttcctgttgttccc
cgcgcgcccatacccccgtccaaccggacccttcgagaccgaaagccgcagagtgccgcc
agcactgccagtgcgaaggctagtcccgcgacctcacccggcaagaagggcgtggcgaag
aacgtagagcgtacgaagaaatccacttctgggtccgagagcgacctgacggacatcacg
agcgggtcgggttcagagaaggcaggtggcgagtcggcgtcgaaaaaactgccgcgggtc
atcctcaagctgggacctgcgcccggggtgtga

DBGET integrated database retrieval system