KEGG   Trametes versicolor: TRAVEDRAFT_28260Help
Entry
TRAVEDRAFT_28260  CDS       T04795                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tvs  Trametes versicolor
Pathway
tvs00020  Citrate cycle (TCA cycle)
tvs00190  Oxidative phosphorylation
tvs01100  Metabolic pathways
tvs01110  Biosynthesis of secondary metabolites
tvs01130  Biosynthesis of antibiotics
tvs01200  Carbon metabolism
Module
tvs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tvs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tvs_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRAVEDRAFT_28260
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TRAVEDRAFT_28260
Enzymes [BR:tvs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TRAVEDRAFT_28260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 TAL_FSA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 19412969
NCBI-ProteinID: XP_008036136
JGI: 28260
LinkDB All DBs
Position
Unknown
AA seq 637 aa AA seqDB search
MFRKSLPRALRATQRSFSSSAPARRVVATNPVKAQEVQGWGKYPLIEHEYDAIVVGAGGA
GLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIHYMCREAPRTVIELEHFGLPFSRTKEGKIYQRAFGGQSLKYGKGGQAYRCAAA
ADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRAHKT
VLATGGYGRAYFSCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYLQLSHLP
AEILHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVITQDKDGNDKV
VPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACATHIKETLTPGKPHAKLPEDVGLH
SVEHLDKIRKADGPLPTAKIRLDMQKAMQADAAVFRTQQSLDEGVEKIRQIYKTYEQVGI
KDRSMIWNSDLVETLELRNLLQCAVQTITAAAARQESRGAHAREDFPDRDDEKWMKHTLT
WQHDIESPDVEIKYRKVIHETLDENECKSVPPFKRVY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaaaatccctccccagggccctccgcgccacgcagcggtccttcagctcctca
gccccggcgcgcagggtcgtcgcgaccaaccctgtcaaggcccaggaggtccagggctgg
ggcaagtaccccctcatcgagcacgagtacgatgctatcgtcgtgggagcgggcggcgcc
ggtttgcgtgcggcatttggtctggcggaagctggattcaacacggcatgcattacgaag
cttttccccacccgtagtcacactgtcgcggcccagggtggtatcaacgctgcgctcggt
aacatgaccgaggacgactggcggtggcacatgtacgacacggtcaagggttccgactgg
cttggtgaccaggacgctattcactacatgtgtcgcgaggcgccccgcaccgttattgag
cttgagcacttcggtttgcccttctcaagaacgaaggagggcaagatctaccagcgtgct
ttcggcggtcagtcgctgaagtacggcaagggtggccaggcctaccgctgcgcagcggcg
gcggatcgtaccgggcacgctctcctccacacgctctacggccagtccctccggcacaac
accaacttcttcatcgagtacttcgcactcgatctcatcatgcaggacggcgaatgcgtt
ggtgtcatcgcgctgaacatggaggatggcaccctccaccgcttccgtgcacacaagact
gtcctggccaccggtggttacgggcgagcgtacttcagctgcacgagtgcgcacacttgc
tcgggtgacggtaacgcgatggttgcgcgtgctggcctgcccttgcaggatcttgagttc
gtgcagttccaccctacgggtatctacggtgctggctgtctcatcactgagggttcgcgt
ggtgagggaggctacctgctcaactcggagggtgagcggttcatggagcgttacgcgcca
acggcaaaggatcttgcgtcccgcgacgtcgtctcgcgttccatgacgattgagatccgt
gagggtcgtggtgtcggtcccgagaaggaccacatctacctccagctcagccacttgccc
gctgagatcctccacgagcgtcttcccggtatctcagagaccgcggcgatcttctctggt
gtcgatgtcaccaaggagcccatccccgtcctccctaccgtccactacaacatgggtggt
attcctacgcgttacaccggtgaggttatcacgcaggacaaggacggcaatgacaaggtc
gtccctggtctgtatgctgccggtgaggctgcttgcgtgtccgtccacggcgccaaccgt
ctcggcgcgaactcgctcctggacatcgtcgtcttcggccgtgcttgcgcaacccacatc
aaggagacgctcacccctggcaagcctcacgcgaagctgcctgaggatgttggtctccac
agcgttgagcaccttgacaagatcaggaaggcggacggtcccctccccaccgctaagatc
cggttggacatgcagaaggccatgcaggccgatgccgcggtcttccgtacccagcagtct
ttggacgagggtgtcgagaagatccgccagatctacaagacctacgagcaggtcggcatc
aaggacaggagcatgatctggaactctgacctcgtcgagaccctcgagctccgcaacctc
ctccagtgcgccgtccagaccatcaccgctgccgccgcccgccaggagtcgcgtggtgcg
cacgcgcgtgaggacttccccgatcgtgacgacgagaaatggatgaagcacacgctcacg
tggcagcacgacatcgagtcgcccgacgtcgagatcaagtaccgcaaggtcatccacgag
acgctcgacgagaacgagtgcaagtccgtgccgccgttcaagcgtgtctactaa

DBGET integrated database retrieval system