KEGG   Trametes versicolor: TRAVEDRAFT_28580Help
Entry
TRAVEDRAFT_28580  CDS       T04795                                 

Definition
(RefSeq) glucoamylase G2
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tvs  Trametes versicolor
Pathway
tvs00500  Starch and sucrose metabolism
tvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRAVEDRAFT_28580
Enzymes [BR:tvs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TRAVEDRAFT_28580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19413029
NCBI-ProteinID: XP_008037229
JGI: 28580
LinkDB All DBs
Position
Unknown
AA seq 579 aa AA seqDB search
MRFTFLATIVGLAVGAFAQSSAADAYVASEGPIAKAGVIANIGSGGSKSSGAKSGVVIAS
PSTSNPDYLYTWTRDSSLVFKALIDQFTSGEDTTLRNLIDNFTASQARLQQVSNPSGTVS
TGGLGEAKFNIDESAFTGGWGRPQRDGPALRATAIITYANWLLDNSNSTYVTQTLWPIIK
LDLDYVQNNWNQTGFDLWEEVNSSSFFTTAVQHRALREGATFAARIGQTSVVSGYTTQAA
NVLCFLQSYWNPSAGYITANTGGGRSGKDSNTVLTSVHTFDPAAGCDANTFQPCSDKALS
NLKVYVDSFRSIYSINSGIAANAAVATGRYPEDSYQGGNPWYLTTIAVSEQLYDALIVWD
KLGSLNVTAVSLPFFQQFSSSVVVGTYPSSSATYTTLTTAIRTFADGFIAVNAKYTPADG
GLAEQYGRASGAPVSAVDLTWSYAATLTAFHARAGKTYAGWGAAGLAVPATCSTSGSGSG
GGAGTVAVTFNVQATTVYGENIYITGSVDALQNWSPGNALILSAANYPTWSITVNLPAST
AIQYKFIRKYNGATTWESDPNNQITTPASGSATQADTWR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcaccttccttgctaccatcgtcggcctcgctgtcggcgcgttcgcccagtct
agcgctgcggacgcgtacgtcgcctccgagggccccatcgcaaaggctggtgtcattgcc
aacatcggctccggcggctccaagtcgtccggcgcgaagtccggtgttgtgatcgccagc
ccgagcacgtctaaccccgactacctctacacctggacgcgcgactcgtccctcgtcttc
aaggcgctcatcgaccagttcacctccggggaggacaccacgctccgcaatctgatcgac
aacttcacggcgtcgcaggcccgcctccagcaggtctccaacccgtccggcaccgtcagc
accggcggtctcggcgaggccaagttcaacatcgacgagagcgcgttcaccggcggctgg
ggtcgtccccagcgcgacggccctgctctccgggctaccgctatcatcacctacgccaac
tggctcctcgacaacagcaactcgacctacgtgacccagaccctctggccgatcatcaag
ctcgacctcgactatgttcagaacaactggaaccagactggcttcgatctttgggaggag
gttaactcttcgtcgttcttcaccaccgccgtccagcaccgcgctctccgcgagggtgcc
accttcgccgcacgcatcggccagacctcggtcgtcagtggctacacaactcaagctgcc
aacgtcctctgtttcctccagtcgtactggaaccccagcgctggctacatcactgctaac
actggtggcggacgctccggcaaggactccaacaccgttctcacctccgtccacaccttc
gaccccgccgcgggatgtgatgccaacacgttccagccctgctcggacaaggcgctctcc
aacctgaaggtctacgtcgactccttccgctccatctacagcatcaactcgggcattgct
gccaacgctgctgttgccaccggccgctaccctgaggacagctaccagggcggtaacccc
tggtacctcacgaccatcgcggtctctgagcagctctacgacgcactcatcgtctgggac
aagctcggcagcctcaacgtcaccgccgtttccttgccgttcttccagcagttctcctcc
agcgtcgtcgtcggcacctacccctcgtcgtccgcgacctacacgacgctcaccaccgcg
atccgcaccttcgccgacggcttcattgccgtaaacgccaagtacacccccgcggacggc
ggccttgctgaacagtacggccgcgccagcggtgcacccgtctccgccgttgacctcacc
tggagctacgccgcgaccctcaccgcgttccacgcgcgtgcgggcaagacctacgccggc
tggggcgccgccggcctcgctgtccccgccacctgctcgacgagcggcagcggcagcggt
ggaggtgccggcaccgttgcggtcaccttcaacgtgcaggcgacgaccgtctacggcgag
aacatctacattaccggctccgtcgacgcgctccagaactggtcgccaggcaacgccctc
attctctccgccgccaactaccccacctggagcatcaccgtgaacttgcccgcgagcacc
gccatccagtataagttcatccgcaagtacaacggtgcgaccacctgggagtccgacccc
aacaaccagatcaccacccccgcgagcggctccgccacccaggccgacacatggcggtaa

DBGET integrated database retrieval system