KEGG   Trametes versicolor: TRAVEDRAFT_30260Help
Entry
TRAVEDRAFT_30260  CDS       T04795                                 

Definition
(RefSeq) glycoside hydrolase family 13 protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tvs  Trametes versicolor
Pathway
tvs00500  Starch and sucrose metabolism
tvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRAVEDRAFT_30260
Enzymes [BR:tvs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TRAVEDRAFT_30260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19413306
NCBI-ProteinID: XP_008040112
JGI: 30260
LinkDB All DBs
Position
Unknown
AA seq 529 aa AA seqDB search
MLRLALLTSLLATSAFAASADEWRNRTIYQVITDRFATSDGSSPSCDTSQRQYCGGTWKG
LVGKLDYIQNMGFDAVWISPVVANVEGNTTYGEAFHGYWTQDINSLNSHFGTADDLKSLS
TALHNRGMYLMVDVVVNHMVGTADPPNFSAFQPFSSQSDFHSECFVSNYDNQTEVEQCWL
GDKNVPLVDINTEDNDVVTTMNNWISTLVSNYSVDGVRIDTVKHVRKDFWPDFAKSAGVF
TIGEVLNNETSYVSAYTQVIDAVLDYPSWFPLVAAFQTSNGNLSALAATVQQAQSSYKDG
EFMTGAFLENHDQPRFQSLTQDSALIKNAMTWPFVQDAIPILYYGQEQSYAGGADPANRE
ALWLSGYVEDKPLVTHVKTLNAARKAAIAANSSFLTTAVKFPSSGSDSTMAILKPPMLAL
LSNGGSSSTPKWTVSDAGFQANEELVDVLTCTKMNADSNGGVTVQGSGGSPQVLIPTSAL
STAGTTCSSLATVTQTSSARGWVDGAADSLPVLAALVLAVWAAQSSLVL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttacgacttgcactccttacgtctctccttgcgacttctgcgttcgccgcgtccgca
gatgaatggcgcaaccgcacgatctaccaggtgatcaccgatcgtttcgccacctccgat
ggctccagcccctcctgcgacacatcccagcgacaatactgtggcggtacctggaagggc
cttgtcggcaagctcgactacatccagaacatgggctttgacgccgtctggatttcgccc
gtagtcgcgaacgtcgaagggaacaccacctatggcgaggctttccacgggtactggacc
caggacatcaactcgctgaactcccatttcggcactgccgatgacctcaagtcgctgagc
actgccctgcacaaccgcggcatgtacctcatggtcgatgtcgtcgtcaaccacatggtc
ggaaccgcggatcctcccaatttctcggccttccagccgttctcctcgcagtccgacttc
cacagcgaatgcttcgtctccaactacgacaaccagaccgaggtcgagcagtgctggcta
ggcgacaagaacgtcccgctggttgacatcaacaccgaggacaacgacgttgttactaca
atgaacaactggatttcgacccttgtcagcaactacagcgtggacggtgtccgcatcgac
acggtcaagcacgtccggaaggacttctggccggactttgccaagtccgccggcgtcttc
acgatcggcgaggttctgaacaacgagacgagctatgtttcagcatacactcaggtcatc
gacgctgttcttgactacccgtcctggttcccgcttgttgccgctttccagacctcgaac
ggcaacctctcggcgttggcagccactgtgcagcaggcccagagttcgtacaaggacggc
gagttcatgactggcgcgttcctcgagaaccacgatcagccccggttccagtcgcttacc
caggacagtgcattgatcaagaacgccatgacttggccgtttgtgcaagacgcgatcccg
atcttgtactacggtcaagagcaatcctacgctggaggcgccgatcctgccaaccgcgaa
gctctctggttgtctggctatgttgaagacaagcccctcgtgacccacgtcaagacgctg
aatgccgctcgcaaggccgcgatcgccgcgaacagctccttcctgaccactgcggtgaag
ttcccgtcgtcgggctcggattccaccatggccatcctgaagccgcccatgctcgcactg
ctttccaacggcggaagttcatcgacgccgaaatggaccgtgtctgatgcgggcttccag
gccaacgaggagctcgtagatgtcctcacttgcaccaagatgaatgcagatagcaacggc
ggtgtcaccgtccaaggatctggaggcagcccgcaggtcctcatcccgacttccgcgctg
agcaccgccggcaccacgtgctcgagcctggcgactgtcacccaaacgtcttctgcccgt
ggatgggtcgatggtgcagcggattctcttccggtgcttgccgcgctcgtcctggccgtc
tgggctgcccagtcgagcctcgtgttgtaa

DBGET integrated database retrieval system