KEGG   Trametes versicolor: TRAVEDRAFT_30462Help
Entry
TRAVEDRAFT_30462  CDS       T04795                                 

Definition
(RefSeq) hypothetical protein
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
tvs  Trametes versicolor
Pathway
tvs00510  N-Glycan biosynthesis
tvs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    TRAVEDRAFT_30462
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tvs01003]
    TRAVEDRAFT_30462
Enzymes [BR:tvs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     TRAVEDRAFT_30462
Glycosyltransferases [BR:tvs01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   TRAVEDRAFT_30462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_transf_21 Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 19413347
NCBI-ProteinID: XP_008040953
JGI: 30462
LinkDB All DBs
Position
Unknown
AA seq 277 aa AA seqDB search
MSSIRYSVIVPAFRENGNIRALVTRIFGALAQVNSPVNPAEVEVIIVDDNSRDGSVETVE
GLRREGYNVRIIVRTTERGLSSAVVRGFREAQGDSMLCMDADLQHPPEYVPAMLASMSPT
KQFALGTRYAAGVEIDEGWPLYRRVISSGARMLALPLTSASDPMSGFFGIRKETFLKARN
LNSDGFKIALDLLVKCAIPGDAIAEVPFSFGVRAEGESKLTGKVMIRYLEQLAELYWYSF
SSLIIFAAILLFVVFVLLARSVLSSYGGLDGKAQSKY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatccgctactcggtcatcgttcccgccttccgggagaatggcaacatccgc
gccctggtcacccgcatcttcggcgcgctagcgcaggtaaactcccccgtgaacccggcg
gaggttgaggtgatcattgtggacgacaactcgcgcgacggctccgtcgagactgtcgaa
ggcctccgccgcgagggctacaacgtccgcatcatcgtccgcacaacagagcgcggcctc
agcagcgcggtcgtgcgcggcttccgggaggcgcagggcgacagcatgctctgcatggac
gcggacctgcaacaccctcccgaatacgtgcccgccatgcttgcatccatgtcgcccaca
aaacaattcgcgctcggtacgcggtacgccgcaggcgtcgagatcgacgagggctggccg
ctttaccgtcgcgtcatctcctccggcgcgcgcatgcttgcgctcccgctcacctccgcc
agcgaccccatgtccggatttttcggcattcgcaaagagacgttcctgaaggcgcgtaac
ctgaactcggacgggttcaagatcgcgctcgacctgcttgtgaagtgcgccatccctggc
gatgcgatcgcggaggtgccgttctcgttcggcgtccgcgcggagggcgagtcgaaactc
accggcaaggtcatgatccgctacctcgagcagctcgcggagctgtactggtacagcttc
agctcgctcatcatcttcgccgcgatcctgctcttcgtcgtattcgtgctcctggcgcgg
tcagtgctcagctcgtatggtggcctcgacgggaaggcgcagagcaagtactga

DBGET integrated database retrieval system