KEGG   Trametes versicolor: TRAVEDRAFT_30524Help
Entry
TRAVEDRAFT_30524  CDS       T04795                                 

Definition
(RefSeq) glycoside hydrolase
Organism
tvs  Trametes versicolor
SSDB OrthologParalogGFIT
Motif
Pfam: CBM_20 Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 19413364
NCBI-ProteinID: XP_008040970
JGI: 30524
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MSKWIKLAALTALGVFFTAADARPAPFDAGADAHSLHTRAPTGSKDVIIQMFEWTWDSVA
SECTNFIGPAGYGFVQVSPPQETIQGDQWWTDYQPVSYILTSKRGSRTSFANMITTCHAA
GVGVIVDTIWNHMAGVDSGTGIAGSSFTHYVYPGIYQNQDFHHCGLEPGDDIVNYDNAVE
VQTCELVNLADLATDTEYVRGRLAQYGNDLLSLGADGLRLDASKHIPVGDIANILSRLNR
TVYITQEVIFGSGEPITPNQYTGNGDVQEFRYTSALKDAFSGSGISSLQDFENRGWVPGT
GANVFVVNHDTERNGNSLNNNSPSNTYVTAMIFSLAHPYGTPSILSSYTGFTNTDLGAPN
GGTGTCSGSGGTNGWLCQHRWTAVAGMVGFRNQVGSAALNNWVAPQSQQIAFGRGSLGFV
AINNADSAWTSTFTTSLPDGTYCDVVSGQTSGTTCTGSSFTVSSGSLSATVPARSAIAVH
TGQLGTGSGSGTGSGGSTTPSGSVTVNFAETATTTFGENIFLVGSIAQLGTWNTANAIAL
SSASYPTWTVSVSIPAGTTFQYKFIRKETDGSVVWESDPNRQATAPASGTSTLSGSWR
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtggatcaaactcgccgcactcaccgccctcggcgtcttcttcaccgccgcc
gatgctcgccccgctcccttcgacgcgggcgcggacgcacactccctgcacaccagggcc
ccgactggcagcaaggatgtcatcatccagatgttcgagtggacctgggacagtgtcgct
tccgagtgcaccaacttcattggtcccgcaggctatggcttcgtgcaagtgagcccgccc
caggagactattcagggcgaccagtggtggaccgactaccagccggtgtcgtacatcctc
acctccaagcgggggagtcgcacctcgtttgcgaacatgatcaccacctgccacgccgcc
ggcgtgggcgtcatcgtcgacaccatctggaaccacatggccggcgtcgactccggcacc
ggtattgcgggttcctccttcacgcactacgtttaccccggcatctaccaaaaccaggac
ttccaccactgcggcttggagcccggagatgatatcgtcaactacgacaacgccgtcgaa
gtccagacctgcgaactcgtcaacctcgctgacctcgcgaccgacaccgagtatgtgcgg
ggccgtctcgcgcagtacggcaacgacctcctctcgttgggtgctgatggcctgcgtctt
gacgcttccaaacacattcccgtcggcgacatcgcgaacattctgtcgcgtttgaaccgc
acggtctacatcacccaggaagtcatcttcggatccggcgaacccatcacgcccaaccag
tacaccggtaacggcgacgttcaggagttccgttacacctccgcgctgaaggatgctttc
tcgggctcaggtatctctagcctccaggacttcgagaaccgcggctgggtacccggcaca
ggtgccaatgtgttcgtcgttaaccacgacacggagcggaacggcaactcgctgaacaac
aactcgccctcgaacacctacgtgaccgcgatgatcttctcgctcgcgcacccgtacggg
acgccctcgatcctgtccagctacaccggcttcacgaacacggacctcggcgcgccgaac
ggcggcacgggcacctgctcgggcagcggcggtacgaacggctggctctgccagcaccgc
tggaccgccgtcgccggcatggtcggcttccgcaaccaggtcggcagtgctgcgctcaac
aactgggtcgcgccgcagtcccagcagatcgcattcggccgtggctcgcttggcttcgtc
gcgatcaacaacgctgactctgcttggacctcgaccttcacaacttcccttcccgacggc
acgtactgcgacgttgtcagcggtcagacctccggcaccacatgcactggatcttcgttc
accgtctccagcggctccctgtccgctaccgtccctgcgcgcagcgcaattgccgtgcac
accggacagctcggaacgggttccggctcgggtactggctcaggcggcagcactaccccc
agcggctccgtcaccgtcaacttcgccgagacggcgacgaccaccttcggcgagaacatc
ttcctcgtcggtagcatcgcccagctcgggacctggaacacggcgaacgcgatcgccctt
tcctccgcgtcgtaccccacatggaccgtgtcggtgagcatccctgcgggcacgacgttc
cagtacaagttcatccgcaaggagacggacggtagcgtcgtctgggagtcggacccgaac
cgccaggccaccgcgcccgcctccggcaccagcaccctctccgggagctggcgatga

DBGET integrated database retrieval system