KEGG   Trametes versicolor: TRAVEDRAFT_46982Help
Entry
TRAVEDRAFT_46982  CDS       T04795                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tvs  Trametes versicolor
Pathway
tvs04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tvs00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    TRAVEDRAFT_46982
Enzymes [BR:tvs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TRAVEDRAFT_46982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 19415465
NCBI-ProteinID: XP_008037450
JGI: 46982
LinkDB All DBs
Position
Unknown
AA seq 200 aa AA seqDB search
MDLSPARQSRQPRFAITASFTLIVVFLIWLLLPRRATLDDEILPPPIISKAVTVLKGEQV
SGTVTFTQTEPTAPVTVSGELKNLDPSAQRGFHIHASGDLSNGCLSAGPHFNPFSRTHGA
PTDKNRHAGDLGNIESDSKGVATFSFEDTFISLNGPLSIVGRAVVVHAGTDDLGRGGDDE
SLKTGNAGARAACGVIGIAA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggatctctcccctgctcgccagtcgaggcagcctcgcttcgccatcaccgcttcgttc
acactcatcgtggtgttcctcatctggctgctcctcccgaggcgcgcgacactggacgat
gagatcctcccgccccccatcatctccaaggcggtgacggtgctgaagggcgagcaagtg
agcggcacggtcacattcacgcagacagagcctaccgcaccagtcaccgtgtccggcgaa
ctcaagaacctggacccctccgcccagcgcgggttccatatacatgcttcgggtgacttg
agcaacggctgcctttccgcaggcccgcactttaacccgttcagccggacccacggtgca
cccaccgacaaaaaccgacatgcgggcgacttgggaaacatcgagagcgactctaagggc
gtggcgaccttctcattcgaggacactttcatctccctgaatgggccgctgagcatcgtt
gggcgcgcagtcgttgttcacgcgggtaccgacgacctcgggagaggtggggacgacgag
tcgctcaaaacaggaaatgccggcgcacgcgccgcttgcggcgtcatcggaatcgctgcc
tga

DBGET integrated database retrieval system