KEGG   Trametes versicolor: TRAVEDRAFT_60698Help
Entry
TRAVEDRAFT_60698  CDS       T04795                                 

Definition
(RefSeq) glutathione S-transferase C-terminal-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tvs  Trametes versicolor
Pathway
tvs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TRAVEDRAFT_60698
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tvs02000]
    TRAVEDRAFT_60698
Enzymes [BR:tvs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TRAVEDRAFT_60698
Transporters [BR:tvs02000]
 Other Transporters
  Pores ion channels [TC:1]
   TRAVEDRAFT_60698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 19418225
NCBI-ProteinID: XP_008043241
JGI: 60698
LinkDB All DBs
Position
Unknown
AA seq 255 aa AA seqDB search
MSNDGNYIHSHATGLAAKTVEQHQAPQDLVLYAGWFCPYVQRSWISLEEKGIPYQYKEVN
PYKKEQHFLDINPKGLVPAIEYKGKAMYESLILCEFFEDAFPEHTPHLLTTDPFDRAYVR
LWVDHVSKQIVPTFMRLVLAQEPEKQQEHLADFYKGLRTLTDKVRGPYFLGAQFSLVDIA
LAPWVLRDYILAENRGYEREAAGSAWVAYAKALETRESVLRTQSDKEHYAQIYARYLRNE
AQSEAAKAIRAGKPF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacggaaactatatccattcccatgcaaccgggttggcggcgaagaccgtg
gagcagcaccaagctccgcaggatcttgtcttatacgcgggatggttctgcccatacgtg
cagcgctcttggatatcccttgaggagaaggggatcccgtaccagtacaaggaagtcaac
ccgtacaagaaggagcaacacttccttgacatcaaccccaagggcctcgtccccgccatc
gagtacaagggcaaggccatgtacgagtcgctcatcctctgcgagttcttcgaggacgcc
ttcccggaacacaccccgcacctcctcaccaccgaccccttcgaccgcgcgtacgtgcgc
ctctgggtcgaccacgtctcgaagcagatcgtgccgacgttcatgcggctcgtcctggcg
caggagccggagaagcaacaggagcacctcgcggacttctacaagggcctgcgcacgctg
accgacaaggtcaggggcccgtacttcctcggggcgcagttcagcctggtcgacatcgcg
ctcgcgccgtgggtgctgcgcgactacatcctcgcggagaaccgcgggtacgagagggag
gcggcggggagtgcgtgggttgcgtacgcgaaggcgctcgagacgcgcgagagcgtgctc
cggacccagagtgacaaagagcattacgcgcagatatacgcgcgatacctccgtaacgag
gcacagagcgaggcagcgaaggcgatcagggctggcaaaccgttctga

DBGET integrated database retrieval system