KEGG   Trametes versicolor: TRAVEDRAFT_64949Help
Entry
TRAVEDRAFT_64949  CDS       T04795                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
tvs  Trametes versicolor
Pathway
tvs03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    TRAVEDRAFT_64949
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tvs03400]
    TRAVEDRAFT_64949
Enzymes [BR:tvs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TRAVEDRAFT_64949
DNA repair and recombination proteins [BR:tvs03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     TRAVEDRAFT_64949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 19418627
NCBI-ProteinID: XP_008038813
JGI: 64949
LinkDB All DBs
Position
Unknown
AA seq 1027 aa AA seqDB search
MQPTPAPSSPPASQLQVPASQLLPPAVAAEDHPIEYPAPPQNKGSAPFQVLVALFEKLQN
ERKPEKRRRLIASWFNGWRKDIGYDLFPVLRLILPQKDRERTVYGLKEKNLAKAYIKLIP
LDRHGPDAIRLLNWKKPTERYRSAGDFPSVLWEVVNKRNNVTEGSLTIDDINGVLDELAQ
NMGKSDLQSKILQRVYNRATSDEQRWLVRIILKDMIISVKENTVFGVFHPDAHDLFNTCS
DLKKVTWELWDPERRLNDEDKAVQLFRAFAPMLCKRPTKKIEDSVKEMQGRAFIIEEKLD
GERIQLHKRGNEYFYCSRKGKDYTYLYGKHVGTGSLTPYIDSAFDPRIDEIILDGEMLVW
DPVSERNLPFGTLKTAAIDRSKKEFNPRPCFKVFDLLYLNGTSLLHKSLKFRKRNLRSCV
IPVAGRIELVTEFEGRTAKDVRTRMDDIIGNRGEGLVMKHPDSEYVLNGRNKDWIKVKPE
YMDNMGETVDVLVVVLTFIAAGNYGSGRRSGGVSTLICAVLDDRRVHNDDDEPKYSTFVR
IGSGLSYADYIWIRQKPWKPWGRDAPSYLQVARKGHDDKGDVYLEPQDSFIVKVKAAEIT
STDMYHLGFTMRFPRALQIRDDLSIADCMTASAVLEGIRSEKKRKMEDDTDKPKKKQNRT
AKKPTMMPEYRGVNLKDVEVEDNLFGDFKFVVSSDPKSRTGADDKKALLQMIHAHGGKYA
QVARNDPNILIVYGGQTTPYDLRLIMDKGVCDIIRPQWILDCVAYEKIVPLTKKYFFHAT
AARKETDEYAEDDSDTEEEPEDEPPSPSPSASRKSKSPPQEEPSQPKEEIKIDPSMAEWF
DVGASLQQSGGSKGGYISGSDTEEDPESDNEDVDPEAASEDEDWEKVDQDSGKSQEESKG
KASEARMGEDDNAMAYDEERIFKHLCLYLDSPSNARKHGMKVDTKREADIEKRFSEMSNV
ITENGGRVVDLDDPKLTHVILDKRDISRRKVLIARTSEPKRRHLVISDWVDACVAEETLL
DEEEFNP
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgacaccagcgccgtcttcgccgcccgcgtcccagcttcaagttcccgcgtcg
caacttctcccaccagcggtggcggcagaagaccatcccatcgagtaccctgctccccct
cagaacaagggaagcgctccatttcaagtccttgtggccctgttcgagaagcttcagaat
gaaagaaagcctgagaagcgtcgaagactgatcgcttcttggtttaacggctggaggaaa
gacatcggatacgacttgttccctgttttgcgattaatcctcccccaaaaagaccgagag
cgcaccgtgtatggcctcaaagagaagaacctcgcgaaggcatacattaagctcattccg
cttgaccgtcacggaccagacgctattagactcctcaactggaagaaacccaccgaacga
taccgctcggcgggtgatttcccttcggtactatgggaggttgtcaataagcggaacaat
gttacggagggatcgttgaccatcgacgacataaacggcgtcctagacgagcttgcccaa
aacatgggcaaatccgatttgcagtccaagattctacagcgagtctacaatagagccact
tcggatgagcagcgatggcttgttcgcatcatcttgaaagacatgattatctccgtgaag
gagaacactgttttcggcgttttccatcctgatgcacacgatctcttcaacacctgttcc
gacctcaaaaaggtcacctgggagctctgggatccagagcggagacttaacgacgaggac
aaagccgttcagctattccgtgcctttgcgcccatgctctgcaaaaggccgactaagaag
atcgaagattctgtcaaggaaatgcagggtcgtgcattcatcatcgaagagaagctcgac
ggtgaacgtatccagctgcataagcgtggaaatgaatacttctactgctctaggaaagga
aaggactacacatatttgtacggaaagcatgtcggaacgggaagcttgacgccctacatc
gactctgcgttcgatccgcgcatcgacgagattattctcgacggcgagatgctggtatgg
gatccggtctccgaacgcaatcttcccttcggcacgctcaagaccgctgctatcgaccga
tctaagaaggagttcaacccgcgcccatgcttcaaggtgttcgacctgctttacctgaac
ggcacatcgctcctgcacaagtctctcaaattccgcaagcgcaatctccgttcctgtgta
atcccagtagcaggacgcatcgagctggtcaccgaattcgaaggacgcactgccaaagat
gtccgaactcgtatggacgacatcataggaaaccgtggagagggattggtcatgaagcat
ccggactctgagtacgtgctgaacggccgcaacaaggactggatcaaggttaaaccggag
tacatggacaacatgggagagacggtcgatgtgcttgtggtcgtcctcacgttcattgca
gctgggaactacggttctggaaggcgttctggaggcgtttccacgctcatttgcgccgta
ctggacgaccgccgcgttcataacgacgatgacgagccaaagtacagcacctttgtccgt
atcggaagcggcctttcgtacgccgactacatttggatccgccaaaagccatggaagcct
tggggacgggacgcccctagttatcttcaagtcgcaagaaaggggcacgacgataaaggc
gacgtttatctcgagccacaggactcgttcatcgtaaaggtcaaggcggcggaaatcacg
agcacggatatgtatcacttgggctttaccatgcggttcccgcgggcactgcagattcga
gacgacctgtcgatcgctgattgtatgacggcctcggcggtcctcgaaggcatccggtct
gagaagaagaggaagatggaggatgataccgataaacccaagaagaagcagaatcgaacc
gcgaagaagccgaccatgatgcccgagtaccgcggcgtcaacctcaaggacgttgaggtc
gaggacaacctcttcggagacttcaagttcgttgtatcttctgaccctaagtcgagaacc
ggcgcggatgacaagaaggcgctgttgcagatgatccatgcacatggcggaaagtacgca
caggttgcccggaacgacccgaacatcctcatcgtctacggcggtcagacaactccatat
gatctcagactcattatggacaagggcgtgtgcgacattatacgcccgcaatggatattg
gactgcgtcgcgtatgagaagatagtaccactcaccaagaagtacttcttccacgccacc
gcagcacgcaaggagacggatgagtatgccgaggacgatagcgacaccgaagaagagccc
gaagatgagccaccctcaccttcgccgtctgcctcacggaagagcaagtctcctccacag
gaggagccttctcagccaaaggaggaaatcaagatagacccatcaatggcggaatggttc
gacgtcggggcgagtctgcagcagagtggtggctcgaaaggcgggtacatatccggcagt
gacacggaggaagacccggagtcggataatgaagacgtcgacccggaagctgcctctgag
gacgaggactgggagaaggtcgatcaggattccggcaagtcgcaagaggagagcaagggg
aaggcttccgaggcgcgcatgggcgaagacgacaacgctatggcctacgacgaagagcgt
atcttcaaacacctgtgcctatacctcgactcgccaagcaacgctcggaagcatggaatg
aaagtcgacactaagagggaggcggacatcgagaaacgtttctcggagatgtcgaatgtg
atcacagagaacggcggccgcgttgtcgacctcgacgatcccaagctgacgcacgtcatc
ctcgacaagcgggatatcagtcggcgcaaggtactcattgcacgcacgtccgagccgaag
cgtagacacctggtgatatcggactgggtcgacgcctgcgtggcagaagagaccttgctg
gatgaggaggagttcaacccgtag

DBGET integrated database retrieval system