KEGG   Trametes versicolor: TRAVEDRAFT_70933Help
Entry
TRAVEDRAFT_70933  CDS       T04795                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tvs  Trametes versicolor
Pathway
tvs00250  Alanine, aspartate and glutamate metabolism
tvs00410  beta-Alanine metabolism
tvs00430  Taurine and hypotaurine metabolism
tvs00650  Butanoate metabolism
tvs01100  Metabolic pathways
tvs01110  Biosynthesis of secondary metabolites
Module
tvs_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TRAVEDRAFT_70933
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRAVEDRAFT_70933
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRAVEDRAFT_70933
   00430 Taurine and hypotaurine metabolism
    TRAVEDRAFT_70933
Enzymes [BR:tvs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     TRAVEDRAFT_70933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19419366
NCBI-ProteinID: XP_008036856
JGI: 70933
LinkDB All DBs
Position
Unknown
AA seq 536 aa AA seqDB search
MSLSKHLNADQLIQSAKDHKGHHVRSSINHQADHAYGARYGTDPIPKYKLPSKGVDAEAA
YQLIHDELSLDGSPALNLASFVHTWMPKQADQLMMENLSKNLIDQDEYPMTQVLHTRCVS
QLADLWHAPSTNQAIGTATTGSSEAIQLGGLAMKRIWQEKRKAAGKSIHEPGPNIVMGAN
AQVALEKFARYFDVECRLVPISEESKYRLDPKRAMDYVDENTIGVYVILGSTYTGHYEPV
KEMSDLLDEYEARTGNSVPIHVDGASGGFVAPFANPKLEWDFRIPRVVSINASGHKFGLA
YVGVGWVVWRAKKFLPKDLIFELHYLGSVEYSFSLNFSRPAHPIIAQYFNFVHLGFEGYR
NVALADLKNARLLSRALEKSGLFTVLSDIHRPVEGVAAAVKGVVGFDEENIENYVPGLPV
VSFRFTDEFRKQNPDVQQKWVQVLLRAKGWIVPNYELAPNLENVEILRVVIRENMTAVMV
DRLVADILEIMESLQKADSPVHALSALQSRKTVEGHHGRLEEGSGSQSSGTYAKQC
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctcaaagcacctcaacgccgatcagctcatccagtctgcaaaggaccacaaa
ggtcaccatgttcgcagctccatcaaccaccaggccgaccatgcatacggcgcccgttac
ggcactgatcccatccccaagtacaagcttccctccaagggtgtggatgcggaggccgcg
taccaactgatccacgacgaactctccctcgatggatccccggccctcaacctggcgtcc
ttcgtccacacatggatgccgaagcaggcagatcagctcatgatggagaacctctccaaa
aatctcatcgaccaggacgaataccccatgacccaggtcctccatacccgctgcgtctcc
cagctcgctgatttgtggcacgcaccctccacgaaccaagcgatcggaaccgccactact
ggctcgtccgaggccatccagcttggcgggcttgcgatgaagcgcatctggcaagagaag
cgcaaggctgccggaaagtccatccacgagcccggtcccaacatcgtgatgggcgcgaac
gcacaggtcgcactcgaaaagttcgctcgctacttcgacgttgagtgccgtctggtaccc
atctctgaggagagcaagtaccggctcgaccccaagcgcgcgatggactacgtcgacgag
aacaccatcggtgtctatgtcatcctcggaagcacctacaccggccactacgagcccgtc
aaagagatgtccgaccttctcgacgagtacgaggcgcgcaccggcaactcagtacccatt
cacgtcgacggcgcatccggcggcttcgtcgcgcccttcgccaaccccaaacttgagtgg
gacttccgcatcccgcgcgtagtctccatcaacgcctccggccacaagttcggtctcgcg
tacgtcggcgtcggctgggtcgtctggcgcgcgaagaagttcctcccgaaggacctcatc
ttcgagctgcactacctcggctcggtcgagtactcgttctcgctcaacttctcgcgcccg
gcgcacccgatcatcgcgcagtacttcaactttgtgcacctcgggttcgagggctaccgc
aatgtcgcgctcgcggacctcaagaacgcccggcttctgagccgtgcgcttgagaagagc
ggcctcttcaccgttctgagtgacatccaccggccagtggaaggcgtcgctgcggctgtg
aagggtgtggtcggcttcgacgaagagaacatcgagaactacgtcccgggattgccagtc
gtgtcgttcaggttcaccgacgagttcaggaagcagaaccccgacgtccagcagaagtgg
gtgcaagtcctcctgcgcgcgaagggctggatcgtcccgaactacgagctcgcacccaac
ctggagaacgtcgagatcctccgtgtcgtcattcgtgaaaacatgaccgcagtgatggtc
gacaggctcgtcgcagacatccttgagatcatggagagcctccagaaggcggacagcccg
gtccacgccctcagtgcgctgcagagccgcaagaccgttgagggccaccacggtcgcctg
gaagaaggctccggcagccagtcgagcgggacatacgccaagcagtgctga

DBGET integrated database retrieval system