KEGG   Thermoactinomyces vulgaris: AB849_001220Help
Entry
AB849_001220      CDS       T05864                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tvu  Thermoactinomyces vulgaris
Pathway
tvu00010  Glycolysis / Gluconeogenesis
tvu00030  Pentose phosphate pathway
tvu00051  Fructose and mannose metabolism
tvu00052  Galactose metabolism
tvu00680  Methane metabolism
tvu01100  Metabolic pathways
tvu01110  Biosynthesis of secondary metabolites
tvu01120  Microbial metabolism in diverse environments
tvu01130  Biosynthesis of antibiotics
tvu01200  Carbon metabolism
tvu01230  Biosynthesis of amino acids
tvu03018  RNA degradation
Module
tvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tvu_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:tvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB849_001220 (pfkA)
   00030 Pentose phosphate pathway
    AB849_001220 (pfkA)
   00051 Fructose and mannose metabolism
    AB849_001220 (pfkA)
   00052 Galactose metabolism
    AB849_001220 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    AB849_001220 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AB849_001220 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tvu01009]
    AB849_001220 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tvu03019]
    AB849_001220 (pfkA)
Enzymes [BR:tvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AB849_001220 (pfkA)
Protein phosphatases and associated proteins [BR:tvu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AB849_001220 (pfkA)
Messenger RNA biogenesis [BR:tvu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AB849_001220 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Peripla_BP_1 GIDE
Motif
Other DBs
NCBI-ProteinID: QBK12371
UniProt: A0A481WGF2
LinkDB All DBs
Position
complement(241050..242009)
Genome map
AA seq 319 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRSGHYHGLEVYGVIRGYSGLINGDIRPLSLRSVGDI
IHRGGTILYSARCKEFQTEEGRKKAVEQLRKHEIDGLVVIGGDGSFRGAQKLTALGFPAV
GVPGTIDNDIPGTDFTIGFDTAVNTVIDCIDKIRDTATSHERTYVIEVMGRNAGDIALWS
GLADGAESILIPESPYDLDDVVNRLKQAAESGKKHSIIIVAEGVGSGVEFAEKIKEKLSV
ETRVTVLGHVQRGGSPTAFDRVLASRMGAKAVDLLRAGEKDKMVAIQNNKLVGIDFDEAF
SMKHQPDMELYDLAKILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtatagctgtacttacaagcggtggtgatgctccgggcatgaacgccgccatt
cgtgccgttgtgcgcagcggacattatcatggcctggaagtgtatggagtgatccgcggt
tattctggtttgatcaacggggatatccgcccgttgagtttaagatcggtcggggatatc
attcatcgcggcggtaccattttatatagtgctcgttgcaaagagtttcaaacagaggaa
ggccggaaaaaagcggtcgagcaattgagaaagcatgaaatcgacggattggtggtcatt
ggcggagacggcagtttccggggagcccaaaaattgacggcattgggtttccctgctgtg
ggggttcccggaaccattgataatgacattccgggtacggatttcacgatcgggtttgac
acagcagtcaacaccgtcatcgactgcattgacaagattcgggataccgccacttcccat
gagcgcacttatgtaatcgaagtgatgggaagaaatgcgggggacattgccctctggtcc
ggattggccgacggggccgaatccatcttgattccggaatcgccgtatgatctggatgat
gtggttaaccggttgaaacaagcagcggaaagcgggaagaaacacagcatcatcattgtt
gccgagggagtgggcagcggcgtcgaatttgcagagaaaatcaaagaaaaactcagcgtt
gagacaagagtgaccgtgttgggacatgtgcagcgcggaggatctcctactgctttcgac
cgtgttttagccagccggatgggagctaaagcggtcgatcttttgcgtgcaggagaaaag
gataaaatggtggcgattcaaaataataaattggtcggaattgactttgatgaggctttt
tccatgaagcatcaacccgatatggaattatatgacttggcaaagatattatcgatttaa

DBGET integrated database retrieval system