KEGG   Thermoactinomyces vulgaris: AB849_005105Help
Entry
AB849_005105      CDS       T05864                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tvu  Thermoactinomyces vulgaris
Brite
KEGG Orthology (KO) [BR:tvu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tvu01001]
    AB849_005105
Enzymes [BR:tvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AB849_005105
Protein kinases [BR:tvu01001]
 Serine/threonine kinases: Other
  Bacterial family
   AB849_005105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo FTA2 RIO1
Motif
Other DBs
NCBI-ProteinID: QBK13026
UniProt: A0A4P9PWX9
LinkDB All DBs
Position
979931..981403
Genome map
AA seq 490 aa AA seqDB search
MIMEGMKLAERYEILHSLGGGGMAVVYKAKDLVIDRYVAIKVMNNSLIHDQDFVRRFIRE
AKAAGSLSHPNIVSVYDVGREGSIYYMVMEYVDGPSLIDLIKKEGPFPPEKAVKIASQIC
DGLSHAHRHGIIHRDIKPHNILVGSDQRYKLTDFGISHLPSAATVKTKTGYVMGSVHYFS
PEQASGRKVDYSSDLYSLGIVIYEMLTKKVPFNGDSSISIALKHLHDPVPDPTTYNPDIS
ESMRQVLMRALEKDPEKRYQTAVELKHALQQALEKPDAYMLPVDRPKKKKSTKFSPKKIG
ILSGVAVVGLFLLTFGIKMIGETKQEKKPDPPSSSPTVSQTPANESRPEWNHKWWKEIPK
EEKTESKMFRDFEVKGADGEYEVTLKVNNDLKGRTFYYDIYVVDGFSSRSVLNGRSVTFH
KDKDQDFTTVDFEVNIPKEAIMPISGEGIAKITIYSLDKKSENRKEKYTIDNLLQMWGTV
PESEGEKKSD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgattatggaaggaatgaagctggcggagagatatgagatccttcactctctgggcggg
ggcggcatggcggttgtatacaaggcaaaggacctggtgattgaccggtatgttgcgatc
aaagtgatgaacaattcgctgattcatgaccaggattttgtccggcgctttatccgggag
gcgaaagcggccggcagtttgtcccatcccaatattgtcagtgtctatgatgtggggcgg
gaaggttccatctattacatggtgatggagtatgtggacggtccgtcgttgattgacctc
attaaaaaagaaggtcctttcccgccggaaaaagcggtgaaaattgcttcacagatatgt
gacggtttgtctcatgcccatcgtcacgggattattcaccgtgacatcaaaccgcacaat
attctggtcggttccgaccaacgttacaagctgaccgatttcgggatttcgcatttgccc
agtgccgccaccgtcaaaaccaaaactggttatgtcatgggatctgttcattatttctcc
ccggaacaagcttcagggagaaaggtggactactcttcggatttatattcattgggaatc
gtgatttatgagatgttgaccaaaaaagttccttttaacggggacagttccatctccatt
gccttgaaacatttgcacgatccggttccggacccgacaacttacaatccggatatttct
gaatcgatgcggcaagtgctgatgcgggcgttggaaaaggatccggaaaaacggtaccaa
acggcagtggaattgaaacacgctttgcaacaagccctggaaaagccggatgcttatatg
ttgccggtggaccggccgaagaagaaaaaatcaaccaaattcagccccaaaaaaatcggg
atcttgtccggtgtggcggttgtcggacttttcctgctgacattcggcatcaaaatgatc
ggggaaaccaagcaggaaaaaaagccggatcctccttcttcctccccgacggtttcgcaa
acaccggcaaacgagtcgcggcctgaatggaaccataaatggtggaaggaaatacccaaa
gaagaaaagaccgaaagcaaaatgtttcgtgattttgaggtgaagggagccgacggcgag
tacgaggtgaccctcaaagtcaacaatgaccttaagggacggactttttattatgatatt
tatgtggtggatggattcagttctcggtcggtgttaaacggccgttcggtcacctttcac
aaagacaaggatcaagattttacaacggtggattttgaagtcaacattcccaaagaagcg
atcatgcccatatcgggtgagggaattgccaaaatcaccatatacagtctcgacaagaaa
tcagagaaccggaaagaaaaatacaccatcgacaatttattgcagatgtggggaacggtc
cccgaatctgaaggagagaaaaaatccgattga

DBGET integrated database retrieval system