KEGG   Thermoactinomyces vulgaris: AB849_005935Help
Entry
AB849_005935      CDS       T05864                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
tvu  Thermoactinomyces vulgaris
Pathway
tvu00340  Histidine metabolism
tvu01100  Metabolic pathways
tvu01110  Biosynthesis of secondary metabolites
tvu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tvu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AB849_005935
Enzymes [BR:tvu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     AB849_005935
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     AB849_005935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: QBK13183
UniProt: A0A481WIU5
LinkDB All DBs
Position
1146925..1147536
Genome map
AA seq 203 aa AA seqDB search
MIHPDDIQFDEKGLVPAILQDAASKEVLTLAYMNREALALTLKTKEAWFYSRSRNQLWHK
GETSGNVQKVVSVQTDCDRDAILVKVLPEGPACHQGTYSCFKEQPEDTAGRFQMINKLES
VIAKKEAERPEGSYTAYLFDKGLDKILKKVGEEASEVIIAAKNRSAEELSNETADLLYHL
FVLLREQKLPLDEVLRVLKDRNQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgatccatccggatgatattcaatttgacgaaaaagggctggtgccggcaatactgcag
gatgcggccagcaaagaagttttgaccttggcttatatgaaccgcgaagcattggcattg
acgctgaagacaaaggaagcctggttttacagccgttcccgcaatcaactttggcataaa
ggggaaacttccggaaatgtgcagaaagtggtgtccgttcagacggactgcgaccgggat
gcgattttggtgaaggtgcttcccgaggggccggcttgccaccaaggaacctactcttgt
tttaaggagcaaccggaagataccgccggccgctttcagatgatcaataagttggaatcg
gtgattgccaaaaaagaagcagaacggcccgaaggctcttatacggcttatttgtttgac
aaaggattggacaagatcttgaaaaaagtcggtgaagaagcttccgaggtgatcattgcc
gccaaaaaccgcagcgccgaagagctgagcaatgaaacggcggatctcctttatcacttg
tttgttttgctgcgggaacaaaaattgcctctggatgaggtgctccgtgtattaaaagat
cggaatcaatag

DBGET integrated database retrieval system