KEGG   Thermoactinomyces vulgaris: AB849_005940Help
Entry
AB849_005940      CDS       T05864                                 

Definition
(GenBank) tetratricopeptide repeat protein
Organism
tvu  Thermoactinomyces vulgaris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_19 TPR_14 TPR_8 TPR_16 TPR_17 TPR_1 TPR_12 TPR_10 Fis1_TPR_C ANAPC3 TPR_18 HrpB1_HrpK Coatomer_E TPR_20 TPR_9 TPR_11 MarR Trp_repressor HTH_psq HTH_6 DUF4919 YfiO TPR_15 HTH_3 Uteroglobin Sigma70_r4 HTH_11 Rrf2 MarR_2 HTH_IclR PDH GntR HNH_repeat
Motif
Other DBs
NCBI-ProteinID: QBK14553
UniProt: A0A481WMR7
LinkDB All DBs
Position
1147988..1149604
Genome map
AA seq 538 aa AA seqDB search
MDAGFFFERALYYLDRHRYDKAVKYFRLATEKEPGNPVNHCNLAGILSELGRFQESNQVL
MSVLEEVDPDLYECWFYMANNAANMGDLERAEEYLLQYLSRDPYGDFAEEAEEMLYMIAQ
ELGRPPKEWKPVNQPGYIEDHERARSYLEEGKFLQAIQLLEEISEAHPEFLAAKNNLALA
YYYTGDLEKATGLIEHVLKIDPNNLHALCNLAVLSRNLGDEKKERAILDMLKKLVPFHQE
NTYKLATTLGILGEHEVAYALFSRLLKVDGIQEPGLYHYTAVAAWNCGRFERARQYWKKA
MNLEGREAIAAFYYKHMDQWVELDQPPKLPYHYQLPFEEQLNRMELFGPNEEIVKQLQSN
LLLRSAFFWALSRGDHQTKRQVIKFLTWFSDDEVKQLLEQFVSQPEEDEELKQLAQMVLR
ELSRTESGEPEDPLPSVIEVNHKWKKVLECCLEHVQETSTAHLCKEIERLWFEWAARNRD
FSVVRKVEGWAAALEYLTAKYHGVAVTQRELAKKYEVSMSTVSRLAKQLETIAKECFS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggatgccggctttttctttgaacgggccttatattaccttgaccgccaccgttacgac
aaagcggtcaaatattttcgtttggcgacggaaaaggaaccgggaaatccggtgaatcac
tgcaacctggccggcattctttcggaactggggcgctttcaagagtccaatcaagtgctg
atgtccgttttggaagaagtggatcctgatttatatgaatgctggttttatatggcgaat
aacgcggccaacatgggcgatttggaacgggccgaagaatatttgttgcaatatttgagc
cgggatccttacggagactttgcagaagaagcagaagaaatgctttacatgattgcccag
gagctcggacgtcccccaaaagaatggaagccggtgaaccagcccggctatattgaggat
catgaaagagcacgcagttatttggaagaagggaagtttctccaggccatacaactgctc
gaagaaatttccgaggcgcatccggagtttttggcggcgaaaaacaatctggcattggct
tattattacacgggggacttggaaaaggcgacgggattgatcgaacatgtgctgaagatc
gaccccaataatctgcatgcattgtgcaatctggcggttttgtcccggaatctcggtgac
gaaaaaaaggaacgggccattcttgatatgttgaaaaaactggttccgtttcatcaggaa
aatacttataaattggcaaccacgctggggattttgggagaacatgaagtggcgtacgca
ttattttcccgccttttgaaagtcgacggaattcaggaacccgggctttaccattacacg
gcggttgcggcttggaactgcggccgctttgaaagagcccggcaatattggaaaaaggca
atgaatctcgaaggcagggaagcgatcgcggctttctattacaaacatatggaccaatgg
gtggagttggatcaaccgccgaagctcccttatcattaccagcttccgtttgaagagcaa
ttaaaccggatggaactgttcggccccaacgaggagattgtcaagcaattacagagcaat
ctgcttttgcgctctgcttttttctgggctttgagccggggcgatcatcaaacgaaaagg
caagtcatcaagtttttgacttggttttcggatgatgaagtgaaacaattgttggagcag
tttgtgtcacaaccggaagaagacgaggaattgaaacagttggcgcaaatggtgcttcgc
gaattgagccgcacggaaagcggggaaccggaagatcctcttccttcggtcattgaagtg
aatcataagtggaaaaaagtgttggaatgctgtctggagcatgttcaggaaacatccacc
gcccacctctgtaaggagatcgaacggctgtggttcgaatgggctgcaagaaaccgtgac
ttttcggtggttcgaaaagtggagggatgggcggcggctctggaatatttgacggcaaaa
tatcatggggtggccgtgactcagcgagaactggccaaaaaatacgaagtatccatgtca
acggtatcccggcttgccaaacagttggaaaccatcgccaaagaatgtttttcctga

DBGET integrated database retrieval system