KEGG   Thermoactinomyces vulgaris: AB849_006565Help
Entry
AB849_006565      CDS       T05864                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tvu  Thermoactinomyces vulgaris
Brite
KEGG Orthology (KO) [BR:tvu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AB849_006565 (ahpF)
Enzymes [BR:tvu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AB849_006565 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO Thi4 FAD_oxidored AlaDh_PNT_C NAD_binding_8 FAD_binding_3 NAD_binding_7 Glutaredoxin FMO-like K_oxygenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: QBK13294
LinkDB All DBs
Position
complement(1282354..1283880)
Genome map
AA seq 508 aa AA seqDB search
MLDAEIKTQLEQYLQLLENDIVLKVSAGSDKVSQDMLAFVDEVAGMSPKIKVEKTTLERT
PSFSVDRVGEDSGIVFAGIPLGHEFSSFVLALLQVSGRPPKVEQSIIDQIKNLDGEYHFE
TYVSLSCTNCPDVVQALNMMSVLNPGIKHTMIEGKAYQEEVESKDILAVPTVYLNGEFFE
SGRMTIGDILKKLGSESDPSEFNKKDPFDVLVIGGGPAGATAAIYAARKGVRTGIIADRF
GGQILDTTTIENFISVKQTDGEKLASQLEAHVRDYPVDVMDSQTVKRIEKKDDMIDIFLE
NGAVLKSKTVIIATGARWRNVGVPGEDKFRNKGVANCTHCDAPLFAGKDVAVIGGGNSGI
ESAIDLAGIANHVTVLEFMPELKADEVLQKRLNSLPNVTVITNAQTKEITGTDKVDGIKY
IDRETGEEHHIKLQGVFVQIGLVPNTEWLEGTVEMDRGQIIVDSKGATNVPGIFAAGDCT
NSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgcagaaataaaaacacaactggaacagtatctccaactattggaaaacgat
atcgttcttaaagtgagcgccggctccgataaagtatcccaagacatgctcgccttcgtg
gatgaagttgcgggcatgtcccccaaaatcaaagtggaaaaaaccacattggagcgcacg
cccagctttagcgtggaccgtgttggagaagattcaggaattgtctttgcaggtattcct
ctgggtcacgagttttcttcctttgtgctggctctgttgcaagtcagcggcagaccgccc
aaagtggagcaaagcattattgaccaaattaaaaatctggatggcgaataccacttcgaa
acatatgtcagcctgagttgcaccaactgcccggatgtggtgcaggctttgaacatgatg
agtgttttgaatccgggtatcaaacacaccatgatcgaaggaaaagcctatcaggaagaa
gtggaaagcaaagacatcctggctgtgcccacggtttacctgaatggcgaatttttcgaa
agcggacggatgacgatcggcgacattctcaaaaaacttggaagcgaatccgacccgtcg
gaattcaataaaaaagatccgttcgatgtcctcgtcatcggcggagggcctgccggcgca
acggcggccatttatgcagcgcgtaaaggggttcgcacaggtatcattgccgaccggttt
ggcggccaaattttggacaccaccaccattgaaaacttcatctccgtcaaacaaaccgac
ggggaaaaactggcttcccaactggaagcgcatgtcagggattaccctgtcgatgtgatg
gattcacaaacggttaaacggatcgaaaagaaagacgacatgattgacatcttcctggaa
aacggtgccgtgttaaaaagcaaaaccgtcattattgcaacgggtgcccgttggcgtaat
gtcggtgttcccggagaagataaattccggaacaaaggtgtggcaaactgcacacactgt
gacgcaccgttattcgccggaaaagacgtggccgtcatcggcggaggaaattccggcatc
gagtcggccatcgacctggcagggatcgccaatcatgtcaccgtcctcgaatttatgcct
gaactaaaagcagacgaagttctgcaaaaacgcctgaacagccttcccaacgtcaccgtg
attaccaatgcccaaaccaaggaaatcactggcacagataaagtggacggaatcaaatat
atcgatcgtgagactggtgaagaacatcacatcaaactgcaaggtgtctttgtccaaatc
ggtctcgtgccgaataccgaatggttggaaggcacggtcgaaatggatcgcggccaaatc
atcgtcgattccaaaggtgccaccaatgttccgggcatctttgccgcaggggattgtacc
aacagtgcctacaaacaaatcatcatttccatgggctccggtgcaaccgccgcattggga
gcatttgactatctgatccgcaattaa

DBGET integrated database retrieval system