KEGG   Thermoanaerobacter wiegelii: Thewi_0566Help
Entry
Thewi_0566        CDS       T01607                                 

Definition
(GenBank) Flagellar assembly factor fliW
  KO
K13626  flagellar assembly factor FliW
Organism
twi  Thermoanaerobacter wiegelii
Brite
KEGG Orthology (KO) [BR:twi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:twi02035]
    Thewi_0566
Bacterial motility proteins [BR:twi02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    Thewi_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliW
Motif
Other DBs
NCBI-ProteinID: AEM78025
UniProt: G2MQX6
LinkDB All DBs
Position
586666..587118
Genome map
AA seq 150 aa AA seqDB search
MQINTKNFGIIEYNPEDVIYFEEGIPGFENLHNFLIITDNKEDMPFKWLQSIDDTDIAFV
IMDPRVFKPNYTFEIDEELKEELQIEDVNHLLVYVIVVIPDEIEKMTANLKAPIIINAKN
NKGKQIILDNDEYLIKHPILEELKNAYSNA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaatacaaaaaactttggtatcatagagtataaccctgaagatgtaatttac
ttcgaagaaggaatacccggctttgaaaacttacacaattttttaataatcactgacaac
aaagaagacatgccttttaaatggcttcaatcaatagatgatactgacatagcttttgta
attatggaccctcgtgtgtttaaacctaattatacttttgaaattgatgaagaattaaaa
gaagaacttcaaatagaggatgtaaaccaccttcttgtatacgtaatcgtagtaatccct
gatgaaatagaaaaaatgacagcaaacctaaaagcccctataattataaatgctaaaaat
aacaaaggcaaacaaattattcttgacaatgatgaatatttaataaagcatccaatattg
gaggaacttaaaaatgcttattctaacgcgtaa

DBGET integrated database retrieval system