KEGG   Thermoanaerobacter wiegelii: Thewi_1808Help
Entry
Thewi_1808        CDS       T01607                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2 TetR_C_6
Motif
Other DBs
NCBI-ProteinID: AEM79199
UniProt: G2MWT7
LinkDB All DBs
Position
complement(1815600..1816169)
Genome map
AA seq 189 aa AA seqDB search
MEERNQSQRILNAAYKCISTKGYANVSLRDIAEEAGVVLSQLHYYFGSKEGLFTEVIKMM
IDKYLKEINEALSVGETAKDKMLSLVKFFKDLLKNNPGLFKLLYDFTGLAMWSSSFNSLL
KDLFNDLSKMIEEKILSNSALGENFKNYSPRAVARMILGAMFGTGIQVILDSNENEILDA
LNATQIIFE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagaaaccaatcgcaaagaatattaaatgctgcatataagtgtatttcaact
aaaggatatgctaatgtttccttaagagacattgcagaggaagctggtgttgtattaagc
caattgcattattattttggcagtaaggaaggactttttacggaggtaataaagatgatg
atagataaatatttaaaagaaataaatgaagctttgagtgttggagaaactgcaaaggat
aagatgctatccttagtgaaattttttaaagacctgcttaaaaataatccgggacttttt
aaactgttgtacgactttacaggtttagccatgtggtcctcttcttttaacagtttatta
aaagatttatttaatgacttatctaaaatgattgaggaaaaaattctaagtaacagtgct
ttaggagagaattttaaaaattattctccacgagcagtggcgagaatgatacttggtgca
atgtttggtacgggaattcaagtgattttagattctaatgaaaatgaaattttggatgcg
ttaaatgccacacaaattatttttgagtaa

DBGET integrated database retrieval system