KEGG   Thermoanaerobacter wiegelii: Thewi_1838Help
Entry
Thewi_1838        CDS       T01607                                 

Definition
(GenBank) ABC-type transporter, periplasmic subunit
  KO
K02016  iron complex transport system substrate-binding protein
Organism
twi  Thermoanaerobacter wiegelii
Brite
KEGG Orthology (KO) [BR:twi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:twi02000]
    Thewi_1838
Transporters [BR:twi02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    Thewi_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 DUF2201
Motif
Other DBs
NCBI-ProteinID: AEM79224
UniProt: G2MXJ4
LinkDB All DBs
Position
complement(1843800..1844942)
Genome map
AA seq 380 aa AA seqDB search
MSKQLKKFNGIVAILLAIVISLTACSKASQNQFQTSQTSKGTVQTITVTDLIGRHVEIKT
PVHKVVGIGPGALRLITYIDGIDRVVGVENIDKKVVNGRAYNMIFQEKLVQLPTIGQGGP
DSTPDAEKLVEVNPDVIFVISLLDKAKADNLQAKTGIPVVVLSYGKLGTFEEDVYTSLEI
IGKIMGKEDRAKEVVDYIKGVQKELQDRTKNIPEDKKPSVYIGALGFKGDHGIESTQSNY
PPFMDVNVKNVADTLGQKGSVMIEREKLLAWNPDIMFIDEGNFDLVKQDYQKNPIFYKSL
KAIKNGNVYGILPYNQYNTNIDTALADSYWVGKVLYPEQFKDIDPVEKAKEIYTLFFGEA
GKSVYDKMKEVYGGFEKIKF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaacaattaaagaaatttaatgggatagttgctattttgttagcgattgtcatt
tctttgacagcttgtagtaaagcttcacaaaatcaatttcaaacttctcaaacttccaag
ggaacagttcaaacaattacagttacagatttaatcggaagacatgtagagataaagact
ccagtacataaagtagtaggtataggtccaggagctttaagacttataacctatatagat
gggattgatagagtcgtaggagtagaaaacatagataaaaaagttgtaaatggtagagcc
tacaacatgatttttcaagagaaattagtacaacttccaactattgggcaaggaggtcct
gattctacgccagacgcagaaaaattagtggaagtaaatccagatgttatttttgtgata
tctttgctcgacaaagccaaagctgacaatttacaagctaaaacaggaattcctgtggta
gttttaagctatgggaaactcgggacttttgaagaggatgtatatacctcgctagagatt
ataggaaagattatgggaaaagaggatagagccaaagaagtagtggactacataaaagga
gttcaaaaagagttacaggatagaacgaagaatataccagaggataaaaagccatctgtc
tatataggtgcgttaggatttaaaggtgaccatggcatagagagtacacaaagtaattat
cctccttttatggatgtaaatgtaaaaaatgtagctgatactttagggcaaaaaggaagc
gttatgatagaaagagagaaattattggcttggaatcctgatataatgttcattgatgaa
ggaaattttgacttggtaaaacaggattatcagaagaatcctatcttttataaaagctta
aaggcaataaaaaatggcaatgtatacggcattttgccgtacaatcagtataatacaaat
attgatacagctttagcagattcttattgggtaggaaaagtcctttatcctgaacaattt
aaagatattgaccctgtagaaaaggctaaggaaatttacaccttattctttggagaagct
ggaaaaagtgtttatgataagatgaaagaagtgtacggtggctttgaaaaaattaaattt
tag

DBGET integrated database retrieval system