KEGG   Thermoanaerobacter wiegelii: Thewi_2257Help
Entry
Thewi_2257        CDS       T01607                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
twi  Thermoanaerobacter wiegelii
Brite
KEGG Orthology (KO) [BR:twi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:twi03012]
    Thewi_2257
   03029 Mitochondrial biogenesis [BR:twi03029]
    Thewi_2257
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:twi04147]
    Thewi_2257
Translation factors [BR:twi03012]
 Eukaryotic Type
  Elongation factors
   Thewi_2257
 Prokaryotic Type
   Thewi_2257
Mitochondrial biogenesis [BR:twi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Thewi_2257
Exosome [BR:twi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Thewi_2257
  Exosomal proteins of breast cancer cells
   Thewi_2257
  Exosomal proteins of colorectal cancer cells
   Thewi_2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: AEM79605
UniProt: G2MWZ3
LinkDB All DBs
Position
complement(2295060..2296262)
Genome map
AA seq 400 aa AA seqDB search
MAKQKFERKKPHVNVGTIGHVDHGKTTLTAAITMVLSKAGMAEAKGYDEIDKAPEERARG
ITINTTHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDPELIELVEMEVRELLNEYEFPGDDTPIVVGSALKALE
CGCGKRECEWCGKIWQLMDVVDEYIPTPERDIDKPFLMPVEDVFTITGRGTVATGRVERG
KVKVGDEVEIIGLTTESRKTVVTGVEMFRKTLDEAQAGDNIGVLLRGVQRDEVERGQVLA
KPGTIKPHTKFEAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVINLPDGVEMVMPG
DHVTIKVELITPIAMEEGLKFAIREGGRTVGAGVVSAIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaaaatttgagaggaagaagccccacgtaaacgtagggacgataggtcac
gtagaccatggtaagacgacgttgacagcagcgataacgatggtattatcgaaggcagga
atggcagaggcgaagggatatgacgagatagacaaggcgccggaggagagagcaagggga
ataacgataaacacgactcacgtagaatatgagacagagaagaggcactatgcgcacgta
gactgtccaggtcatgctgactatgtaaagaacatgataacaggggcagcacagatggac
ggggcgatattagtagtatcagcagcagacggaccgatgccacagacgagggaacacata
ttattggcgaggcaggtaggagtgccatatatagtagtatttttaaacaaggcagacatg
gtagacgatccagaattaatagaattagtagagatggaagtaagggaattattgaatgaa
tatgagtttccgggggatgacacaccgatagtagtagggtcagcacttaaggcattagag
tgtggatgtggcaagagagagtgcgaatggtgcgggaagatatggcagttaatggatgta
gtagacgaatatataccgacaccggagagagacatagacaagccattcttaatgccagta
gaggacgtatttacgataacaggaagaggaactgttgcgacagggagagtagagagaggg
aaggtaaaggtaggagacgaagtagagataataggattgacgacggaatcaaggaagaca
gtagtaacaggggtagagatgttcaggaagacactggatgaggcgcaagcaggagacaac
ataggagtattattaagaggagtacagagggacgaagtagagagagggcaagtattagcg
aagccagggacgataaagccgcacacgaaatttgaggcacaagtttacgtattgacgaag
gaagaaggaggaaggcacacaccatttttcaatggatacaggccacaattttactttagg
acgacagacgtgacaggtgtaataaacttaccggatggagtagagatggtaatgccaggg
gaccacgtaacgataaaagtagagttaataacaccgatagcgatggaagaaggtttgaag
tttgctataagagaaggcggccgtacagtaggtgctggcgtcgtgtcagctatcatagaa
tag

DBGET integrated database retrieval system