KEGG   Tropheryma whipplei TW08/27: TW555Help
Entry
TW555             CDS       T00117                                 

Definition
(GenBank) putative eukaryotic-type serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tws  Tropheryma whipplei TW08/27
Brite
KEGG Orthology (KO) [BR:tws00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tws01001]
    TW555
Enzymes [BR:tws01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TW555
Protein kinases [BR:tws01001]
 Serine/threonine kinases: Other
  Bacterial family
   TW555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Haspin_kinase APH Pkinase_fungal Seadorna_VP7 Kinase-like Kdo GNVR
Motif
Other DBs
NCBI-ProteinID: CAD67221
LinkDB All DBs
Position
590691..592496
Genome map
AA seq 601 aa AA seqDB search
MRDAASVIGMRIADRYLITEKIASGGMATVYKGKDIRLKRDVSIKIMHDHLVDDPKFTEK
FIAEAQLAAGISNANIVNVFDQGRENRIAYMVMEYVPGITLRKLLREKHVLTVKQTLEII
TCVLEGLSSAHKSGLIHRDIKPENILIGNNGQIKLGDFGLSRLASNNTTTGTGLLGTIAY
LSPELITRSEADTRSDVYAIGIMLFELLTGQQPFHGKQPMEVAHKHANLPMPKPSAVNPG
VPSVIDDIVLWACSKNPEQRPSDASVLLNALKKINLENEYSTIDATEIIDFGASENKLKT
PQKKMIIKLLVVIALPVVLVSSGFVSWYFIAGPGSTVEITDLAGLTPEEIKEQLEKKGLT
VTISQKYDKSVPSGGIINLPSAGTAWERDKTLELDISLGPRVFDIKGLAGLPISEALSLL
RDRDIKIYRQEEHFSGTVSSGLVISVKKKSGDDISHGGRVSENDELYILSSLGAIPNLIG
MPEEDAKEALANAGLAVGAITQEYNDNYPKGRVIRQTPSGDPVTKGSAINFVVSKGPDLV
IVPNLTGKTLHDAVDALTSLGFRVYLTTSIPLDARPAKIITTPSAGTAVKRGSRVTVTTP
G
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagggatgcagcttccgtaataggcatgcgcatagcggaccgttacctcattaccgag
aaaatagcatccggcggtatggccacggtgtataaagggaaagatataaggctaaagagg
gatgtatcaataaaaataatgcatgaccacttggtcgatgatccaaagtttactgaaaag
tttattgctgaagcacaattggcagcgggcatttctaatgcaaatatagtaaacgtcttt
gatcagggtagggaaaatagaatcgcctacatggttatggaatacgttcccggcataaca
ctcagaaaacttcttcgcgaaaaacatgtcttaaccgtaaaacagactctcgaaataata
acttgtgttctagaaggcttatcatctgcccataagtccggacttatacacagggatata
aaaccagagaacatactgattggaaacaatggacagataaaacttggtgactttggtcta
agtagattggcaagcaacaatacaacaaccggaacaggtctcttgggtacaatcgcctat
ttatctcccgagctaatcacaaggtcagaggcagacactagaagcgatgtgtatgcgatt
ggaatcatgctctttgagctattaaccggacagcaaccgttccacggcaagcagccgatg
gaggttgcgcacaaacacgccaacttaccgatgccaaagccaagtgcagtcaacccaggt
gtgccctccgtaattgatgacattgtgctgtgggcctgctccaagaatccagaacagagg
ccatcggatgcctctgttctgttgaatgcattgaagaaaataaatctcgagaatgaatat
tcaactattgatgcaacagaaataatagacttcggcgcctcagaaaataaattaaaaaca
ccgcaaaaaaaaatgattataaaactactagtagtaattgctctaccggttgttcttgtg
tcttcagggtttgtcagttggtactttattgcaggccctggtagtacggtcgagattacg
gatctagctgggcttacacctgaagaaataaaagaacaacttgagaaaaagggccttacg
gttacaatatcccaaaaatacgacaaatctgttccatcggggggaatcataaacctaccc
agtgcgggcacggcgtgggaaagagataaaactttagagcttgatatctcgctcggaccc
agagtatttgatattaaaggccttgccggattgccgatcagtgaggctctaagcctatta
cgcgatagggatataaagatatacagacaggaagaacattttagcggcactgtatcctcc
ggactggttatttccgtaaaaaagaaatcgggtgatgatatttcacatgggggaagggtc
agcgagaatgatgaactgtatatcctgtcaagccttggggcaattccaaatctaataggc
atgccagaagaagatgctaaagaagcacttgccaacgccggtctagcggtcggggcaatt
actcaagaatataacgataattacccaaaaggccgtgttatacggcaaacaccatccggt
gaccctgtaacaaaaggatctgcgatcaattttgttgtctctaaaggacctgatcttgtc
atagtgccaaacctaacaggaaaaacactgcatgatgcagttgacgctttgacatctctg
gggtttcgagtgtacctgacaacctctattcctcttgatgcaaggccggcaaagataata
acaaccccctctgcgggcacggcggtaaaacggggaagccgtgtaaccgtaacaacaccc
ggataa

DBGET integrated database retrieval system