KEGG   Thalassospira xiamenensis: TH3_01290Help
Entry
TH3_01290         CDS       T03639                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
txi  Thalassospira xiamenensis
Pathway
txi00020  Citrate cycle (TCA cycle)
txi00310  Lysine degradation
txi00380  Tryptophan metabolism
txi01100  Metabolic pathways
txi01110  Biosynthesis of secondary metabolites
txi01120  Microbial metabolism in diverse environments
txi01130  Biosynthesis of antibiotics
txi01200  Carbon metabolism
Module
txi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
txi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:txi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TH3_01290 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    TH3_01290 (sucA)
   00380 Tryptophan metabolism
    TH3_01290 (sucA)
Enzymes [BR:txi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     TH3_01290 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N AA_synth
Motif
Other DBs
NCBI-ProteinID: AJD50384
UniProt: A0A0B4XPW6
LinkDB All DBs
Position
complement(288349..291261)
Genome map
AA seq 970 aa AA seqDB search
MKPQDIDTILNESNATYIAELYARYQSNPTAVDQSWAEFFDGLQDDASDLLAEMQGPSWQ
PRETKVVGGMEGYDVSQGHAERPANGGYAPAAHAAQQTAPVSSDAIRAAAHDSIRALMLI
RSYRVRGHLEANLDPLGLAPRDPHPELDPKTYGFTEADMDRPIYIANVLGLETATVRQIV
SLARKTYCGSIGIEFMHIQEPEQKSWIQQRVESIGNQTQFTARGKEAILERLVEAEGFEN
YLHTKYVGTKRFGIDGGEALMPALEQILKRGSQLGIREVVFGMPHRGRLNVLANVLNKPF
QAIFSEFMGNPSKPDDVMGSGDVKYHLGTSADREFDGNVVHLSLTANPSHLEAVNTVVLG
KVRAKQAQRKDTAREQVMGILLHGDAAFAGQGLVAETFDLSHLKGYRTGGTIHFVVNNQI
GFTTKPSDSRSSPYCSDIAKVVQAPIIHVNGDDPEAVVHAARIATEFRQEFKQDVVIDMF
CYRRFGHNESDEPAFTQPKMYDVIGKHPTTKDIYAQKLVKEGLLTEERVKELDQKFQSHL
DDEFKASEAYRPNKADWLEGKWSGLASSHGEDADWTGQTGVENDLLQEVGRALSTPPSDY
DINKKILRQLKAKAKMFETGEGIDWATGEALAFGTLMCEGTPVRLSGQDCQRGTFSQRHA
KLVDQTNEAKYTPLNNIRTGQAELEVLNSPLSEAGVLGFEYGITLAEPHSLVLWEAQFGD
FANGAQVIIDQFISSGEAKWLRMSGLVMLLPHGYEGQGPEHSSARLERYLQLCGENNMQV
ANVTTPANYYHILRRQIRRSFRKPLILMTPKSLLRHKQAVSPLSEFGPGTVFKSVISETG
KLTDAKKVKRVVLSAGKVYYDLLAERENRGIDDVALVRVEQLYPWPAKELAEELAKYPNA
DVVWCQEEPENMGSWYFVDRRIEGVLSEIKHKASRPIYVGRKAAASPATGLLKAHLREQA
ELVDAALSVK
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcaagatatcgacacgattctgaacgagtcgaacgcaacctacatcgctgaa
ctttatgcccggtatcagagcaacccaactgcggttgatcagagctgggccgagtttttt
gacgggttgcaggacgacgcctccgatctccttgccgaaatgcagggacccagctggcag
ccgcgggaaaccaaggttgttggcggtatggaaggttacgacgtctcacagggccacgcc
gaacgtcccgccaatggcggttacgcaccggcggcccacgccgcacaacagaccgcgccg
gtcagctccgacgccatccgtgccgcggcacatgattcgattcgcgccctgatgctgatc
cgctcctatcgcgtgcgcggccatctcgaagcgaatcttgatccgctgggccttgccccg
cgcgatccgcacccggaactcgatccgaaaacctatggcttcaccgaagccgacatggat
cgcccgatctacatcgccaatgttcttggccttgaaaccgcgaccgttcgtcagatcgta
tcgttggcccgcaaaacctattgcggctcgatcggcatcgaattcatgcatatccaggaa
cccgaacagaaatcctggattcagcagcgcgtcgaaagcatcggcaaccagacacagttt
accgcacgcggcaaggaagccatccttgaacgtctggtcgaagccgaaggtttcgaaaac
tatctgcacaccaaatatgtcggcaccaagcgtttcggcatcgacggtggcgaagccctg
atgccggcccttgaacagatcctcaaacgcggcagccagcttggcatccgcgaggtcgtg
ttcggcatgccgcaccgtggtcgtctgaacgttctggccaatgtgctcaacaaaccgttc
caggcgatcttctcggaattcatgggcaacccgtccaagccggacgacgtgatgggctct
ggtgacgtcaaatatcaccttgggacgtccgctgaccgcgaatttgacggtaacgttgtt
cacctgtcgctgaccgcgaacccgtcccacctcgaagcggtaaacaccgtcgttctgggc
aaggtccgcgccaaacaggcacagcgcaaggacaccgcacgcgaacaggtcatgggtatc
ctccttcacggggatgcggcctttgccggtcagggtcttgtcgctgaaaccttcgatctg
tcgcacctcaaaggctatcgtaccggcggtacgatccactttgtcgtcaacaaccagatc
ggtttcaccaccaagccgtccgatagccgttcttcgccttactgctcggatattgccaag
gtcgttcaggcgccgatcatccatgtcaatggtgacgacccagaagccgtggttcacgcc
gcacgcatcgcgaccgaattccgtcaggaattcaaacaggacgttgtcatcgacatgttc
tgctatcgccgctttggccacaacgaaagcgacgaaccggccttcacccagcccaagatg
tatgacgtgatcggcaaacacccgaccaccaaggacatctacgcccagaagctggtcaag
gaaggtcttctgaccgaagaacgcgtcaaggaactggatcagaaattccagagccacctt
gacgacgaattcaaggcctccgaagcctatcgcccgaacaaggcagactggctcgaaggc
aaatggtcgggcctcgcctcctcgcacggcgaagatgcggactggaccggtcagaccggt
gtggaaaacgacttgttgcaggaagttggccgggcactttcgaccccgcccagcgactat
gacatcaacaagaaaatcctgcgccagctcaaggccaaggccaagatgttcgaaaccggc
gaaggcatcgactgggcaaccggtgaagccctcgcattcggcaccctgatgtgcgaaggc
acaccggtgcgtctgtccggtcaggattgccagcgcggcaccttctcgcagcgtcacgca
aaactggtcgatcagaccaacgaggcaaaatacaccccgctcaacaacatccgtaccggc
caggccgagcttgaagtcctcaactcgcccctgtccgaagccggtgttctgggcttcgaa
tatggcatcacccttgccgaaccgcattcgctggttctctgggaagcccagttcggtgat
tttgccaacggtgcacaggtcatcattgaccagttcatcagctcgggcgaagccaaatgg
ctgcgcatgtcgggtctggtgatgctgttgccgcacggttacgaaggtcagggcccggaa
cacagttccgcccgtctggaacggtatttgcagctttgtggtgaaaacaacatgcaggtg
gccaacgtcacgacccctgcaaactattaccacatcctgcgccgccagatccgccgttcg
ttccgcaagcctctgatcctgatgacgccgaaatcgcttctgcgtcacaaacaggcggtc
tcgccgctgtccgaattcggaccggggaccgtcttcaaatcagtgatcagcgaaaccggc
aaactgaccgatgccaaaaaggtcaaacgcgtcgtcctgtcggcgggcaaggtctattac
gatctgctcgctgaacgcgaaaaccgcgggattgacgatgttgccctggtgcgcgtcgaa
cagctctatccgtggccggccaaggaactggcagaagaacttgccaaatatcccaatgcc
gacgtggtctggtgtcaggaagaacccgaaaacatggggtcctggtacttcgtcgatcgt
cgtatcgaaggcgtgctgtctgaaatcaaacacaaggccagccgcccgatctatgtcggt
cgcaaggctgccgcgtccccggcaacgggcttgctcaaggctcacctgcgcgaacaggcc
gaactggtcgatgccgcgctgagcgtaaaataa

DBGET integrated database retrieval system