KEGG   Thalassospira xiamenensis: TH3_08780Help
Entry
TH3_08780         CDS       T03639                                 

Definition
(GenBank) extracellular solute-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
txi  Thalassospira xiamenensis
Pathway
txi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:txi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    TH3_08780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:txi02000]
    TH3_08780
Transporters [BR:txi02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    TH3_08780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_1 SBP_bac_11 Tk-SP_N-pro
Motif
Other DBs
NCBI-ProteinID: AJD51874
UniProt: A0A0B4XUB9
LinkDB All DBs
Position
1881247..1882269
Genome map
AA seq 340 aa AA seqDB search
MTSLRNKVFGIMGAVVGLTAFHANAAEEVNVYSLRQPFLIEPMFKQFTQETGIRVNTLFS
QSGLVERIKHEGRNSPADLLLTVDIGRIQDAVDADIATPLQSDVIDANIPEQFRDQDHLW
VGLTTRARVLYTSLDRVKPDAISTYEELADPEWKGRICVRSGMHVYNIALVASMIAHHGE
EYTKTWLQGLKDNLARKPQGADIDQIEAVSQGVCDLAIGNSYYYGKMLDDPNKADAAKDV
RIVFPNQGDRGTHVNISGVALIKNAPNKENAIKLVEFLSGDEAQHMYADVNFEYPVKPGV
AWSEMVRSWGTFKSDTLPLNEVANNRGAAIRLIDEVGFNE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactgcgcaacaaggtctttggcattatgggcgcggtggtcggattgacggca
tttcatgcgaatgctgccgaggaggtgaatgtatattcgcttcgccagcctttcctgatt
gaaccgatgttcaaacaattcactcaggaaaccggcatccgggtcaatacgctgttttcg
caaagcggtctggtcgaacgtatcaaacatgagggccgcaacagtccggctgatcttttg
ctgacggttgatatcgggcgcatccaggatgctgttgatgccgatatcgcaacaccgctt
caaagcgatgtgatcgatgccaatatccccgaacaattccgagatcaggaccatctgtgg
gttggtctgaccactcgtgcacgtgttctttatacgtcgcttgatcgtgtgaagcccgac
gccatttcgacatacgaagaacttgccgatccggaatggaaggggcgcatttgtgtccgt
tctggaatgcatgtttacaatatcgcactggtggcctcgatgattgcccatcatggcgag
gaatacacaaaaacctggcttcagggactgaaagacaatcttgcgcgcaaaccgcaaggg
gctgatatcgaccagatcgaggccgtatcgcagggtgtttgtgatctggcaatcggcaat
tcctattattacggcaagatgcttgatgatccgaacaaagccgatgccgccaaggatgtc
cggattgttttccccaatcagggtgaccgcggtacgcatgtgaatatttcgggtgttgcg
ctgatcaagaatgcacccaacaaggaaaatgcgatcaagctggtcgaattcctatcgggg
gacgaagcgcagcatatgtatgctgacgtcaattttgaatacccggtcaagccgggggtg
gcatggtcggaaatggtccgttcctggggaactttcaaatccgacacgctgccgcttaac
gaagttgccaacaatcgtggcgccgccattcgtctgatcgacgaagtcggctttaacgaa
tag

DBGET integrated database retrieval system