KEGG   Thalassospira xiamenensis: TH3_10315Help
Entry
TH3_10315         CDS       T03639                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
txi  Thalassospira xiamenensis
Pathway
txi00010  Glycolysis / Gluconeogenesis
txi00020  Citrate cycle (TCA cycle)
txi00620  Pyruvate metabolism
txi01100  Metabolic pathways
txi01110  Biosynthesis of secondary metabolites
txi01120  Microbial metabolism in diverse environments
txi01130  Biosynthesis of antibiotics
txi01200  Carbon metabolism
Module
txi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:txi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TH3_10315
   00020 Citrate cycle (TCA cycle)
    TH3_10315
   00620 Pyruvate metabolism
    TH3_10315
Enzymes [BR:txi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TH3_10315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N HlyD_3 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AJD52179
UniProt: A0A0B4XV99
LinkDB All DBs
Position
complement(2204929..2206260)
Genome map
AA seq 443 aa AA seqDB search
MPVKILMPALSPTMTEGTLAKWLVKEGDTVESGDVIAEIETDKATMEVEAVDEGKIGKIL
VYEGSEGVAVNEVIALLLEEGEDASALDGADTSSASVGGGDAEPAAEAPKQEASKPEAAP
AKGLAPAAPVSGGDRIKASPLARRIAANEGVDLGKVEGSGPRGRVVKRDVEAAMSSKPAD
KAASAAASSAPAGEKPAAAPQAPVASGWNPDLTGLPEYEEIPNSSMRKVIARRLTQSKQQ
VPHFYLTVDCELDNLLATRKQLNEKAGEGVKVSVNDFVIRAASIALKRVPAANAVWTDAA
ILQSKQQDISVAVAIEGGLITPVIRNAGGKGLAEISTEMKALAGKAREGKLKPEEFQGGT
FSVSNLGMFGIKEFSAIINPPQGCILAVGAGEQRAVVKDGALAIATVMSCTLSVDHRVVD
GAIGAEFMAEFKKLIEDPLSMLL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttaagatattgatgccggctctgtcgccgaccatgaccgaaggcaccttggcg
aaatggcttgtcaaggaaggcgacaccgttgagtcaggtgacgtcattgccgaaatcgaa
accgataaagccacgatggaagttgaagccgtcgacgaaggcaaaatcggtaaaatcctt
gtttacgaaggcagcgaaggcgttgccgtgaacgaggttatcgcacttcttctggaagaa
ggcgaagatgccagcgcccttgacggggcggatacgtcttcggcgtctgttggcggcggc
gatgccgaaccggcagccgaggcaccgaaacaggaagcgtccaagccagaagccgccccg
gcaaaaggcctggcacctgcggcacctgtttccggtggggatcgtatcaaggcaagccca
ttggcgcgtcgtattgcagccaatgaaggcgttgatcttggcaaggtcgagggttcaggc
ccgcgtggtcgtgttgtgaaacgcgatgtcgaagccgcgatgtcgtccaaaccggccgat
aaagctgcttctgctgctgcttcttcggctcctgctggcgagaaaccggcggcagccccg
caggcaccggtggcgtctggctggaacccggatctgaccggtttgccggaatacgaagaa
atcccgaacagctcgatgcgcaaggttattgcccgtcgtctgacccagtccaaacagcag
gttccgcatttctacctgacggtcgattgcgaactcgacaatctgcttgccacccgcaag
cagcttaacgagaaggccggcgagggtgtgaaggtttcggtcaatgatttcgtcattcgt
gccgcatccattgcgcttaaacgcgtaccggcagccaatgcggtttggaccgatgcggcc
atcctgcagagcaagcagcaggacatttcggtggcggttgccatcgagggcggcctgatc
accccggttatccgcaatgcgggtggcaaggggcttgccgaaatctcgaccgagatgaag
gcactggctggcaaggcacgcgaaggcaagctgaaaccggaagaattccagggcgggact
ttctctgtctctaaccttggcatgtttggcatcaaggaattctctgccatcatcaacccg
ccgcagggctgcattctggccgttggtgccggtgaacagcgcgcggttgtcaaggacggc
gccttggctattgccaccgtcatgagctgcacgctttcggtcgaccatcgtgtggtcgat
ggtgcgatcggtgctgaattcatggctgaattcaaaaagctgatcgaagatccgctgagc
atgttgctctga

DBGET integrated database retrieval system