KEGG   Thalassospira xiamenensis: TH3_15835Help
Entry
TH3_15835         CDS       T03639                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
txi  Thalassospira xiamenensis
Pathway
txi00473  D-Alanine metabolism
txi00550  Peptidoglycan biosynthesis
txi01100  Metabolic pathways
txi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:txi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TH3_15835
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TH3_15835
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    TH3_15835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:txi01011]
    TH3_15835
Enzymes [BR:txi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TH3_15835
Peptidoglycan biosynthesis and degradation proteins [BR:txi01011]
 Precursor biosynthesis
  Amino acid ligase
   TH3_15835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp CPSase_L_D2 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AJD53271
UniProt: A0A0B4Y1C3
LinkDB All DBs
Position
3452834..3453748
Genome map
AA seq 304 aa AA seqDB search
MSKHVAVIYGGWSAERPVSLSSGTECIKALREKGYRVTEIDADRDLAAQLAAIDPKPDVV
FNALHGRWGEDGCVQGLLEIMGIPYTHSGVRASSIAMDKMSAKAMFMEYDIPCARHVWVS
RDEIAAGNALPPPYVLKPNNEGSSVGVEIILTPEEEQNMLAREWTHGDGVMQEEFIPGRE
MTVAVKDGKAMEIIEIMTGNHAFYDFESKYVAGGSEHIIPADIPGDLRAKIQDCAEKAYR
ALGCRGIARADFRYDPAEDRVAILEINTQPGMTPTSLVPDAARHDGLSFADIVAWMVEDA
SCER
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcatgtcgccgtcatttatggcggctggtccgcagaacgccccgtttccctg
tcctcgggcacggaatgcatcaaggcgctgcgtgaaaagggctaccgcgtcaccgaaatt
gatgccgaccgcgaccttgccgcacagcttgccgcgattgatcccaaacccgatgtcgtg
ttcaacgccctgcatggtcgctggggcgaggatggctgcgtgcaagggttgcttgaaatc
atgggcattccctatacccattcgggcgtgcgcgcatcctccatcgccatggataaaatg
tcggccaaggcgatgttcatggaatatgacatcccgtgtgcccgccatgtctgggtgtcg
cgcgatgaaattgccgcgggtaatgccctgccgccaccctatgttctcaaacccaataac
gaaggatcatccgttggggtggaaatcatcctgacgcccgaggaagaacagaacatgctg
gcccgcgaatggacgcatggcgacggcgtgatgcaggaagaattcattcccggccgcgaa
atgaccgtggcggtcaaggatggcaaggcgatggaaatcatcgaaatcatgaccggcaat
catgccttttatgattttgaatcaaaatatgtcgccggcgggtccgaacatatcatcccg
gccgatatccccggtgaccttcgcgccaaaattcaggattgcgccgaaaaggcctatcgt
gcgcttggctgccgcgggattgcgcgcgccgatttccgctatgacccggccgaggaccgc
gtcgcaatccttgaaatcaacacccagcccggtatgaccccgacatcgcttgtccccgat
gccgcccgtcatgacggtctaagcttcgccgacattgtcgcctggatggtcgaggatgcc
tcatgcgaacgctga

DBGET integrated database retrieval system