KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0272Help
Entry
Thexy_0272        CDS       T01505                                 

Definition
(GenBank) germination protein, Ger(x)C family
  KO
K06297  spore germination protein KC
Organism
txy  Thermoanaerobacterium xylanolyticum
Brite
KEGG Orthology (KO) [BR:txy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    Thexy_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_GerAC
Motif
Other DBs
NCBI-ProteinID: AEF16328
UniProt: F6BGB0
LinkDB All DBs
Position
289418..290587
Genome map
AA seq 389 aa AA seqDB search
MKRVLILFIILSLLLTGCWDKREINELAFVQGIGMDIDKDKMCNITVQILKPANLATSSG
GGGGGAAAGKPYEVYSSRGVDFAKAFSNFNTELSRTLFLQHNEIIFIGENLARSGVYSML
DFITRNPEFRRTSYLVVVSGGTLDDLMKLSKNVEKYPYREILGMIQNQKNTSSAYVCDIN
HFVETLETEKVQPIVGRLEIVKKDGKPQHVRFVGAAAFKYDKMVGFLTEQETKGIMWMDN
LIKNTSLVVDKGPKGDRTHISFTIIKANSTITPKVSGEDVSFDVKINFDSNMIEQNSRYN
LTDLKMIKSLENLQQEKVKSEVLDALNAVQKKYKVDSAGLGQKLQEKYPKVWEKLKDRWD
EIYPNVKVNVSVKATLKRSGLTSKPIEPR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagggttttgattttgtttatcatactatcattgcttcttacaggctgctgggac
aagagggagataaatgagctggcgtttgttcaaggtataggaatggacatagacaaagat
aagatgtgcaatatcactgtacaaattttaaagccggcaaatttagctacaagttctggc
ggaggcggtggtggtgctgcggcaggaaagccgtatgaagtgtacagctcaagaggtgtc
gactttgccaaggcattttcgaatttcaatacagagctttcaaggacgcttttcctccag
cacaatgaaataatatttataggtgagaatcttgcaaggtcaggtgtttacagcatgctg
gactttatcacgaggaatcctgagtttagaaggacatcttatctggtggtggtatccgga
ggaaccctcgatgaccttatgaaattgtcaaagaatgttgaaaagtacccttaccgtgaa
atcctcggaatgattcaaaaccaaaagaacacatcttcagcgtatgtatgcgatataaac
cattttgtagagactttagagacagaaaaggtacaacctatagtagggagattggagatc
gtaaagaaagatggcaagccgcaacacgtaagatttgtaggtgctgcagcttttaagtat
gataagatggttggatttctgacagaacaagagacaaaaggcataatgtggatggataac
ttgataaaaaatacatcgcttgttgttgataaaggaccaaaaggagacaggacgcacatt
tcatttactataataaaagccaattctaccatcacgcctaaagtaagcggtgaagatgtc
tcttttgatgtcaaaatcaattttgactcaaacatgatagagcagaattcaaggtacaac
cttacagatcttaagatgataaaaagccttgaaaatctgcagcaagagaaggtaaaaagc
gaagtcttggatgctttaaatgcagttcagaaaaagtataaggttgactctgcaggatta
ggacagaagcttcaagaaaaataccctaaagtgtgggaaaaattgaaggatagatgggat
gagatttatccaaacgtaaaggtgaatgtaagcgtgaaggccacactaaagaggtctgga
cttacttcaaagccaattgaaccaaggtaa

DBGET integrated database retrieval system