KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0418Help
Entry
Thexy_0418        CDS       T01505                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy00473  D-Alanine metabolism
txy01100  Metabolic pathways
txy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:txy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Thexy_0418
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Thexy_0418
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:txy01011]
    Thexy_0418
Enzymes [BR:txy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Thexy_0418
Peptidoglycan biosynthesis and degradation proteins [BR:txy01011]
 Precursor biosynthesis
  Racemase
   Thexy_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TH1 Dimerisation
Motif
Other DBs
NCBI-ProteinID: AEF16472
UniProt: F6BH28
LinkDB All DBs
Position
423602..424768
Genome map
AA seq 388 aa AA seqDB search
MLNLYRPTWAEVNLDNIIHNYKEIRKITDKNAGIMAVVKANAYGHGSYEVSKELINCGVD
YLAVATIDEALELREQGISKPILILGYTPAKFADVIVKHDITQTAFELSYVKEVAKVAQK
LGKDAKIHVKIDTGMGRIGYNDMNKAYEEILTMSNLAGINIEGIFSHFSSSDEKDKEYTL
RQLEIFLNLIERLKKSGLYIPIRHIANSAAILDMPETHLDMVRPGIILYGSFPSSEVNKK
IDLLPTISLRSKVVYVKDVGEGEYISYNRTYRTNRKSRIATLPIGYADGLNRLLSNNHNV
IINGKYAPIVGKICMDQCMVDVTEIEDVKEGDVATIMGEADGKFISADEIANKLKTISYE
VYCGISRRVPRIYIFNGEITKVENYLKC
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatttgtatagaccaacatgggcagaagttaatttggataatataattcacaac
tacaaagagataagaaaaatcactgataaaaatgctggcataatggcagtagtcaaggcg
aatgcctatgggcatggttcgtatgaagtgtcgaaggaattgataaattgtggtgtagat
tatctggctgttgcaacaatagacgaggctctggaactaagagagcagggtatatcaaag
ccaatactcattttaggatatactccagcaaagtttgctgatgtgattgtaaagcacgat
attactcagacagcatttgagctaagttacgtaaaagaggtagcaaaggtggctcaaaag
cttggtaaagatgctaagattcatgttaagatagacacagggatgggtcgcatcggctac
aatgacatgaataaagcttatgaggagattttaaccatgtcaaatcttgctggaatcaac
attgaaggcatatttagccatttttcgtcatcagacgaaaaagacaaggaatatacgtta
agacagcttgagatctttttaaatcttatagaaaggcttaaaaagtcgggcttatacatt
cctattaggcacatagcaaacagtgctgcaatattagacatgccggaaacacaccttgac
atggtaagaccggggattatactttacggcagtttcccttcaagtgaagttaataaaaaa
atcgatttacttccaactatatcattaagatctaaagtcgtctatgttaaagatgtgggt
gaaggagaatatataagctacaacaggacgtataggacaaacagaaaaagccgcatagca
actttgcctataggatatgcggatggcttaaataggcttttatcaaataatcacaatgtc
ataataaatggcaaatacgctcctatagttggtaaaatatgcatggatcaatgtatggtt
gatgtgacagagattgaagatgttaaggaaggagatgttgctactattatgggagaagca
gatggcaaattcataagcgctgatgaaattgcaaataaattaaaaactatctcttatgaa
gtatattgtggaatatccagacgggtaccaagaatatatatatttaatggagagataaca
aaagtagaaaattatttaaaatgttaa

DBGET integrated database retrieval system