KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0939
Entry
Thexy_0939        CDS       T01505                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
txy  Thermoanaerobacterium xylanolyticum
Brite
KEGG Orthology (KO) [BR:txy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Thexy_0939
Enzymes [BR:txy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     Thexy_0939
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AEF16977
UniProt: F6BJS0
LinkDB
Position
994939..996405
AA seq 488 aa
MALNNKVQLITYPDSLGGDLKTLNDVLEKYFSDVFGGIHILPPFPSSGDRGFAPITYSEI
DPKFGSWYDIKKMADNFDILLDLMVNHVSRRSIYFQDFLKKGRMSEYADMFITLDKLWKD
GKPVKTDIEKMFLRRTLPYSTFKIEETGEEERVWTTFGKTDPSEQIDLDVNSHLVREFLL
EVFKTFSNFGVNIVRLDAVGYVIKKMGTSCFFVEPDIYEFLNWIKGQAASYGIELLLEVH
SQFEVQYKLAERGFWIYDFILPFTVLYTLINRSNEMLYDYLKNRPMNQFTMLDCHDGIPV
KPDLDGLIDTKKAKEVVDICVQRGANLSLIYGDKYKSEDGFDVHQIGCTYYSALNCDDDA
YLAARAIQFFTPGIPQVYYVGLLAGVNDFEAVKRTKEGREINRHNYGLNEIEESVQKDVV
QRLLKLIRFRNRYEAFNGEFLVEDCKDDEIRLTWEKDDKHCSLFIDLGSYRTIVNYVDEN
GKDVEYIV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgcttaataataaagtacagctaataacttatccagattcattgggcggtgatcta
aaaactttaaatgatgtattagaaaaatatttttctgatgtatttggcggtattcacatt
ttgccgccttttccatcatctggtgatagagggtttgcaccaataacatacagcgagata
gaccctaaatttggatcatggtacgacattaagaaaatggctgataattttgatattctt
ttagacttaatggttaatcatgtatcaagaagatctatttattttcaggatttcttaaaa
aaaggaagaatgtcagaatacgctgatatgtttattacattggataaactttggaaggat
ggcaaacctgtcaaaaccgatatagaaaaaatgtttttgcgaaggactttgccatattca
acatttaaaatagaagaaacaggagaagaagaaagagtttggacgacttttggaaagaca
gatccatcagaacaaatcgatttggatgtcaactcacatttagtaagagaatttttatta
gaagtctttaaaacatttagcaattttggtgttaatatagtccgacttgatgcagtagga
tatgtaataaaaaaaatgggaactagctgtttctttgtggaaccggatatatacgaattt
ttaaactggataaaaggacaagcagcatcttatggaatagaactgcttttggaggtacat
tcgcaatttgaagtacaatacaaattggcagagcgtggattttggatttatgattttatt
ttgccgtttactgttctttatactttaataaacagatcaaatgaaatgttgtatgattat
ctaaaaaaccgtcctatgaatcaatttacaatgttggattgccatgatggaattcctgta
aaacctgatttggatggacttattgatacgaagaaagctaaagaagtggtcgatatatgt
gtgcaaagaggtgcgaatctaagccttatatacggagataaatataaatcagaagatggt
tttgatgtacatcaaattgggtgcacatattattcagcattaaattgtgatgatgatgca
tatttagcagccagagctattcaattttttacaccaggtataccacaagtctattacgta
ggtcttttagctggagtaaatgactttgaagcagtaaaaaggacaaaagaagggcgagag
ataaatagacacaattatggtttaaatgaaatagaggaatcagttcagaaagacgtcgtt
cagagattactaaagttgatcagatttagaaatagatatgaagcttttaatggagaattt
ttagtagaagactgtaaagatgatgaaattaggcttacttgggaaaaagatgataaacat
tgtagtttattcatagatttggggtcatacaggacaatcgttaattatgtagatgaaaat
ggaaaagatgtggaatatatagtgtaa

DBGET integrated database retrieval system