KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1610Help
Entry
Thexy_1610        CDS       T01505                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
txy  Thermoanaerobacterium xylanolyticum
Brite
Enzymes [BR:txy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Thexy_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF3106
Motif
Other DBs
NCBI-ProteinID: AEF17640
UniProt: F6BHP1
LinkDB All DBs
Position
1658875..1659471
Genome map
AA seq 198 aa AA seqDB search
MKRLIPKKYNLVLNGISQKTLQEHYKLYEGYVSKTNEIWEKLTTSDREKANATYSEYREL
KLEETYALDGVKLHELYFENLGGTGGPATGIIASMITCDFGSYENWLNDFKACALSSRGW
TVLCFDPIDLKLHNYLQDLHNHGVISRSTPLLIIDTYEHAYFIDYGTDKKGYIDAFMNNV
KWDEVNKRVYNWIDTKKI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaggttgatacctaaaaagtataacttggtattaaacggcatatcacaaaagacg
ttgcaagagcattataaattgtatgaaggatatgtatcgaagacaaatgaaatttgggag
aaattaaccacatctgatagagaaaaagcaaatgcaacatacagtgaatatagagagctt
aagctggaagaaacatatgcattagatggcgtaaaactgcacgagctttacttcgaaaac
cttggtggaacaggtggtcctgcaacaggaataattgcttctatgataacatgcgatttc
ggttcttatgaaaactggcttaacgactttaaagcatgtgcactatcgtcaaggggctgg
acagttctttgctttgacccaattgacttaaagcttcacaattatttgcaggatcttcac
aatcatggcgtcatttcaagatcgactccacttttaataatcgacacttacgaacatgca
tatttcatagattatgggacagacaaaaagggatacattgacgctttcatgaacaatgtc
aaatgggatgaagtaaataaacgtgtatacaattggatcgatacaaagaaaatttag

DBGET integrated database retrieval system