KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1895Help
Entry
Thexy_1895        CDS       T01505                                 

Definition
(GenBank) flagellar operon protein TIGR03826
Organism
txy  Thermoanaerobacterium xylanolyticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zinc-ribbons_6 DZR HypA SepF Sgf11 VSP zf-CHY OrfB_Zn_ribbon DUF35_N C1_2
Motif
Other DBs
NCBI-ProteinID: AEF17914
UniProt: F6BJ97
LinkDB All DBs
Position
complement(1966345..1966755)
Genome map
AA seq 136 aa AA seqDB search
MDIKNCKRCGKLYNYTGFDLCPECFNKDEEDFIKIRDYIERNPQATVVEVSKATDVEVKR
ILDFLKEGRLILGSKNTNISLTCERCGKKILSGRYCESCSRELERSLKGALNADKIDESF
EKLYLRDEKKDTKRKY
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggatataaagaattgtaaaagatgtggaaagctttataactatactgggtttgattta
tgtccagaatgttttaacaaagatgaagaagacttcataaaaatcagagattacattgag
agaaatccgcaagccacagttgtagaagtgtctaaagcaacagatgtggaagtaaaaaga
atattggactttttaaaagaaggcagactcatattgggctctaaaaacaccaatatttca
ttgacttgtgaaagatgcggtaaaaagatattgtcaggcagatactgtgaatcatgttca
agagaacttgaaaggtctttaaaaggtgcattaaatgctgataaaattgacgaaagtttt
gaaaaactttatttgagagatgaaaaaaaggacactaaaagaaaatattaa

DBGET integrated database retrieval system