KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1896Help
Entry
Thexy_1896        CDS       T01505                                 

Definition
(GenBank) phosphoribosyltransferase
Organism
txy  Thermoanaerobacterium xylanolyticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran PRTase_3 C1_1 UPRTase PRTase_2 His_Phos_1 DZR Pribosyl_synth Prok-RING_1 zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: AEF17915
UniProt: F6BJ98
LinkDB All DBs
Position
complement(1966764..1967453)
Genome map
AA seq 229 aa AA seqDB search
MIFLDLLFPPKTNCLLCGKVIKEGKICFECENKLPFIIGNRCSVCGKPIRDGDRCPDCME
INHVFTRSISPFEYDETIKSLIARFKYYKERSLAEFFAEYMYRCIQEAGIKFDVIVPVPL
HRTKLDERGYNQSELLARELSYRFDVIMSKPLRRIKNTKSQTELKREERMKNLKGAFKVV
YGDLVKDKTILLVDDVLTTGSTLDECAKVLRESGAKDVFAATIATGRNV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatttttcttgatttactttttccgccaaagacaaattgtttgctttgcggcaaagtc
ataaaagaaggcaaaatatgctttgaatgtgaaaataaattgccattcattatcgggaat
aggtgctctgtgtgtggaaagcctattagagatggcgatagatgccctgactgcatggaa
ataaaccatgtttttactcgcagcataagtccttttgagtatgacgaaacgataaaatca
ttgattgccagattcaagtactacaaagagagaagtttagctgaattttttgcagaatac
atgtatagatgtattcaagaagctggtataaagtttgatgttatagtacctgtaccactt
cataggacgaagctggatgagcggggatacaaccaatcagagcttttggcgagagagctt
tcttatagattcgacgtaatcatgtcaaagcctttgagacgtataaaaaacactaaatcc
cagaccgaacttaaaagagaagagcgcatgaaaaacttaaaaggtgcttttaaggtagtt
tatggcgatcttgttaaagacaagaccatacttttggtggatgatgttttgacaacaggt
tctacccttgatgaatgtgcaaaagttttaagagaaagcggtgcaaaagatgtttttgca
gctacaattgcaacaggaaggaatgtgtga

DBGET integrated database retrieval system