KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0986Help
Entry
THEYE_A0986       CDS       T00775                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Brite
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     THEYE_A0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 6943269
NCBI-ProteinID: YP_002248818
UniProt: B5YKQ3
LinkDB All DBs
Position
complement(952489..953067)
Genome map
AA seq 192 aa AA seqDB search
MPYEAKDYSKLIGMPGFSETLLKNHFTLYQGYVTNTNKVLEILETMLKEGKTTIPEYAEL
KRRLGWEWNGVRLHEYYFENLGGDGVFPKDGKLAKLINENFGSFENWLKDFKATGTMRGI
GWIILYQDILSGKLINFWINEHDVGHPAGCNPLLIMDVFEHAFMIDYGLKRADYIEAFFK
NINWKEVEKRIR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgccatatgaggcaaaggattattcaaaactgattggcatgccaggttttagtgagaca
cttcttaaaaatcacttcacactataccagggatatgttacaaacacaaataaagttctt
gagattcttgaaacaatgttaaaggaaggcaaaacaaccatacccgagtatgcagaactt
aaaagaaggcttggctgggaatggaatggtgttagacttcatgagtactactttgaaaat
cttggtggagatggagtatttccaaaggatgggaaattagcaaaacttatcaatgaaaac
ttcggaagttttgaaaactggcttaaggattttaaagccacaggcacaatgcgtggtata
ggctggataattctatatcaggatatcctctcaggaaaattaattaatttctggattaat
gaacatgatgtagggcatccagctggctgcaatccccttctaataatggacgtttttgaa
catgcattcatgattgattatggactaaaaagagcagattacattgaagccttctttaaa
aacataaactggaaagaagtagaaaaaagaattagatag

DBGET integrated database retrieval system