KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1319Help
Entry
THEYE_A1319       CDS       T00775                                 

Definition
(RefSeq) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00473  D-Alanine metabolism
tye00550  Peptidoglycan biosynthesis
tye01100  Metabolic pathways
tye01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    THEYE_A1319
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THEYE_A1319
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    THEYE_A1319
Enzymes [BR:tye01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     THEYE_A1319
Peptidoglycan biosynthesis and degradation proteins [BR:tye01011]
 Precursor biosynthesis
  Amino acid ligase
   THEYE_A1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 RimK ATP-grasp_4 ATP-grasp_3 GARS_A ATP-grasp ATPgrasp_ST ATPgrasp_Ter TTL ATPgrasp_YheCD ATP-grasp_2 Ntox33
Motif
Other DBs
NCBI-GeneID: 6941962
NCBI-ProteinID: YP_002249129
UniProt: B5YFT1
LinkDB All DBs
Position
complement(1277665..1278579)
Genome map
AA seq 304 aa AA seqDB search
MKVGVIAGGISSEREVSLRSGQAVFNALKELGYDVVFIDAGIDLCEKIKIEKIDIAFLVL
HGGWGENGAVQGMLEVMGIPYTGSGVLASALAMDKEASKKIFLYHGIPVPPFKVLNKKDY
ISSAVSLSSFSFPCVVKPAEEGSSIGVNIVKNEREFKNAINEAFQFGKRVIIEKFIEGRE
IHIGVLGDKALGGVEVRPKKGFYSYEAKYTKGLTEYILPPEIDNALYEKLKELGLKAHKS
LNCKGGTRVDMIVDQQGNPYVLEVNTIPGMTETSLLPKIASLAGYDFKGLVKEILELSLK
NNEK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttggagtaatcgcgggaggaatttcctcagagagagaagtctctcttaggagt
ggacaggcggtcttcaatgccttaaaagaacttggatatgatgtggtatttatagatgca
ggaatagacctttgtgagaagataaaaatagaaaaaattgatatagcttttcttgttctt
catggtggatggggagaaaatggagcagttcaggggatgcttgaagttatgggtattcca
tatactggttcaggagttcttgcttctgctctggcaatggataaggaagcatcaaagaag
atatttctttatcacggtattcctgttcctccttttaaagtgcttaataaaaaagattat
ataagttcagccgttagtctatcatcttttagttttccctgtgttgtaaaacctgcagag
gaaggatcatctataggagtaaacattgttaaaaatgagagagagtttaagaatgcaatt
aatgaagcattccaatttgggaaacgagtaattatagagaaatttattgaaggcagagaa
atacatattggagtattaggagataaagctcttggaggagttgaagtaagacctaaaaaa
ggtttttacagctatgaagcaaagtatacaaaaggtttgactgaatatatactgcctcct
gagatagataatgctctttatgagaaactcaaagaacttggactcaaagctcataagtcg
ctaaattgtaaagggggtacaagggttgatatgatagttgatcaacaaggtaatccttat
gttcttgaagtaaatacaattcctggcatgacagaaacatctcttttacctaaaatagct
tcacttgctggttatgattttaaaggtttagttaaagagattctggaactttcacttaaa
aataatgaaaagtaa

DBGET integrated database retrieval system