KEGG   Ursus arctos horribilis: 113240706
Entry
113240706         CDS       T05909                                 

Gene name
VEGFD
Definition
(RefSeq) vascular endothelial growth factor D isoform X1
  KO
K05449  vascular endothelial growth factor C/D
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04668  TNF signaling pathway
uah04926  Relaxin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113240706 (VEGFD)
   04015 Rap1 signaling pathway
    113240706 (VEGFD)
   04010 MAPK signaling pathway
    113240706 (VEGFD)
   04668 TNF signaling pathway
    113240706 (VEGFD)
   04151 PI3K-Akt signaling pathway
    113240706 (VEGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113240706 (VEGFD)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    113240706 (VEGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113240706 (VEGFD)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113240706 (VEGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113240706 (VEGFD)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113240706 (VEGFD)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 113240706
NCBI-ProteinID: XP_026333871
UniProt: A0A3Q7TE17
LinkDB
Position
Unknown
AA seq 354 aa
MYRQWAMLNVFMMSYLQLMQGSSYEHGPVKRASRSTLERSEQQIRAASGLEELLRITHFE
DWKLWRCRLKLKSLTSTDSRSTSHRATRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
ASELGRSTDTFFKPPCVNVFRCGGCCNEESLVCMNTSTSYVSKQLFEISVPLTSVPELVP
VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDHCSHSKKLCPIDMLWDNDKCKCVLQEE
NPLVGMEDHSHLQELALCGPHMKFDEDRCECVCKTPCPRDLIQHPENCSCMECRESLESC
CRQHKIFHADTCSCEDRCPFHTRTCANGKPACAKHCRFPKEKRAACGLHGQENP
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtacagacaatgggccatgctgaatgttttcatgatgtcttacctgcagttgatgcag
ggctccagttatgaacatggaccagtgaagcgggcatcaaggtcaacattagaacggtct
gaacagcagattagggcagcttctggtttggaggaactgttgcgaatcacacacttcgag
gactggaagctgtggagatgccggctgaagctcaaaagtctgactagcacagactctcgc
tccacatcccatcgggccaccaggtttgcggcaactttctatgacattgaaaccctaaaa
gttatagacgaggaatggcagcgcactcagtgcagccccagagagacgtgcgtggaggtg
gccagcgagctgggcaggagcaccgacacgttcttcaagccgccctgcgtgaacgtgttc
cggtgtggcggctgctgcaatgaagagagcctcgtctgtatgaacacgagcacctcctac
gtttccaaacagctctttgagatatcagtgcctttgacttcagtaccggaattagtgcct
gttaaagttgccaaccatacaggttgtaagtgcttgcccactgctccccgccatccatac
tccattatcagaagatccatccagatcccagaagaagatcactgttcccattccaagaaa
ctctgtcctattgacatgctgtgggataacgacaaatgtaaatgtgttttacaggaggag
aatccacttgttggaatggaagaccactctcatctccaggaactggctctctgtgggccg
cacatgaagtttgacgaagatcgttgtgagtgtgtctgtaaaacaccgtgtcccagagat
ctcatccagcaccccgaaaactgcagttgcatggagtgcagagagagcctggagagctgc
tgccggcagcacaagatatttcatgcagacacctgcagctgtgaggacagatgtcccttt
cacaccagaacgtgtgcaaatggaaaaccagcatgtgcaaagcattgccgctttccaaag
gagaagagggctgcctgtgggctccacggtcaagaaaatccttga

KEGG   Ursus arctos horribilis: 113241764
Entry
113241764         CDS       T05909                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B isoform X1
  KO
K17386  platelet-derived growth factor subunit B
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04630  Jak-STAT signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05200  Pathways in cancer
uah05206  MicroRNAs in cancer
uah05211  Renal cell carcinoma
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05231  Choline metabolism in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113241764 (PDGFB)
   04015 Rap1 signaling pathway
    113241764 (PDGFB)
   04010 MAPK signaling pathway
    113241764 (PDGFB)
   04630 Jak-STAT signaling pathway
    113241764 (PDGFB)
   04072 Phospholipase D signaling pathway
    113241764 (PDGFB)
   04151 PI3K-Akt signaling pathway
    113241764 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113241764 (PDGFB)
   04540 Gap junction
    113241764 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113241764 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113241764 (PDGFB)
   05206 MicroRNAs in cancer
    113241764 (PDGFB)
   05231 Choline metabolism in cancer
    113241764 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    113241764 (PDGFB)
   05218 Melanoma
    113241764 (PDGFB)
   05211 Renal cell carcinoma
    113241764 (PDGFB)
   05215 Prostate cancer
    113241764 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113241764 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    113241764 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113241764 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113241764 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113241764 (PDGFB)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113241764 (PDGFB)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113241764 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 113241764
NCBI-ProteinID: XP_026335388
UniProt: A0A3Q7UXA5
LinkDB
Position
Unknown
AA seq 242 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGASVDEDGAEL
DLNLTRSHSGGELESLSRGRRSLGSPTVAEPAVIAECKTRTEVFEISRRLIDHTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKC
ETVVAARPVTRSLGSTQEQRAAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKKALKETL
GA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctctacgagatgctgagtgaccactcgatccgctcc
tttgatgacctccagcgtctgctgcacggagcctccgtagacgaagacggggccgagctg
gacctgaatttgacccgatcccattctggaggcgagctggagagcttatcccgagggaga
aggagcctaggttccccgacggtcgccgagccggccgtgatcgccgagtgcaagacgcgc
actgaggtgttcgagatctcgcggcgcctcatagaccacaccaacgctaacttcctggtg
tggccgccgtgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcggcccgtccaggtgagaaaaatcgagattgtacgg
aagaagccaacctttaagaaggccacggtgaccctggaggaccacctggcgtgcaagtgt
gagacagtggtggctgctcgacctgtgacccgaagcctggggagtacccaggagcaacga
gcagccaagacaccccaaactcgggtgaccattcggacggtgcgagtccgccggcccccc
aaggggaagcaccggaagttcaagcacacgcatgacaagaaggcgctgaaggagaccctc
ggagcctag

KEGG   Ursus arctos horribilis: 113242141
Entry
113242141         CDS       T05909                                 

Gene name
FGF16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113242141 (FGF16)
   04015 Rap1 signaling pathway
    113242141 (FGF16)
   04010 MAPK signaling pathway
    113242141 (FGF16)
   04151 PI3K-Akt signaling pathway
    113242141 (FGF16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113242141 (FGF16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113242141 (FGF16)
  09162 Cancer: specific types
   05226 Gastric cancer
    113242141 (FGF16)
   05218 Melanoma
    113242141 (FGF16)
   05224 Breast cancer
    113242141 (FGF16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113242141 (FGF16)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113242141 (FGF16)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113242141 (FGF16)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113242141 (FGF16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113242141
NCBI-ProteinID: XP_026335897
UniProt: A0A3Q7VDI0
LinkDB
Position
Unknown
AA seq 207 aa
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHLDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFRYK
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggtggggggggtcttcgcctccttggactgggatctacacggcttctcctcg
tctctggggaacgtgcccttagctgactccccgggtttcctgaacgagcgcctaggccag
atcgaggggaagctgcagcgcggctcgcccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctctactgccgcacgggcttccacctggagatcttccccaacggcacg
gtgcacggcacccgccacgaccacagccgtttcggaatcctggagtttatcagcctggct
gtggggttgatcagcatccggggagtggactctggcctgtacttaggaatgaatgagcga
ggagaactatatgggtcgaagaaactcacacgtgaatgtgttttccgggaacaatttgaa
gaaaactggtacaacacctatgcttccaccttgtacaaacacttggactcggagagacag
tattatgtggccttgaataaagacggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttgcccaggccagtagatccttctaagttgccctccatgtcc
agagacctcttccgttataagtaa

KEGG   Ursus arctos horribilis: 113242699
Entry
113242699         CDS       T05909                                 

Gene name
FGF22
Definition
(RefSeq) fibroblast growth factor 22 isoform X1
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113242699 (FGF22)
   04015 Rap1 signaling pathway
    113242699 (FGF22)
   04010 MAPK signaling pathway
    113242699 (FGF22)
   04151 PI3K-Akt signaling pathway
    113242699 (FGF22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113242699 (FGF22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113242699 (FGF22)
  09162 Cancer: specific types
   05226 Gastric cancer
    113242699 (FGF22)
   05218 Melanoma
    113242699 (FGF22)
   05224 Breast cancer
    113242699 (FGF22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113242699 (FGF22)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113242699 (FGF22)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113242699 (FGF22)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113242699 (FGF22)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 113242699
NCBI-ProteinID: XP_026336619
UniProt: A0A3Q7V139
LinkDB
Position
Unknown
AA seq 171 aa
MGGRLWLGLAWLLLARPPGAAGTPGSPRRPRSYPHLEGDVRWRRLFSSTHFFLRVDPSGR
VQGTRWRHGADSIIEIRSIRVGVVALKAVHTGFYVAMNRRGHLYGSVPGAHRGERLQHLR
LAPLASPWSAHVPGAGWAGGPAAWWPDTAAPPIHPLPACPGLLRSLRPQDA
NT seq 516 nt   +upstreamnt  +downstreamnt
atgggcggccgcctgtggctgggcctggcgtggctgctgctggcacggccgcccggcgcc
gcggggaccccgggcagtccgcggagaccgcgcagctacccacacctggagggcgacgtg
cgctggcggcgcctcttctcctccacccacttcttcctgcgcgtggaccccagcggccgc
gtgcagggcacccgctggcgccacggcgccgacagcatcattgagatccgctccatccgc
gtgggcgtcgtggccctcaaggctgtgcacaccggcttctacgtggccatgaaccgcagg
ggccacctctacgggtcggttccaggagcgcatcgaggagaacggctacaacacctacgc
ctcgctccgctggcgtcaccatggtcggcccatgttcctggcgctggatgggcagggggc
cccgcggcgtggtggccggacacagcggcaccacctatccacccacttcctgcctgtcct
ggtctcctgaggtccctacgtccgcaggatgcctga

KEGG   Ursus arctos horribilis: 113242727
Entry
113242727         CDS       T05909                                 

Gene name
EFNA2
Definition
(RefSeq) ephrin-A2 isoform X1
  KO
K05462  ephrin-A
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04360  Axon guidance
uah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113242727 (EFNA2)
   04015 Rap1 signaling pathway
    113242727 (EFNA2)
   04010 MAPK signaling pathway
    113242727 (EFNA2)
   04151 PI3K-Akt signaling pathway
    113242727 (EFNA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    113242727 (EFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    113242727 (EFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113242727 (EFNA2)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113242727 (EFNA2)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113242727 (EFNA2)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   113242727 (EFNA2)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 113242727
NCBI-ProteinID: XP_026336682
UniProt: A0A3Q7VFK5
LinkDB
Position
Unknown
AA seq 214 aa
MAPAQRPLLPLLLLLLPLPPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAADDGGGY
TVEVSINDYLDIYCPHYGAPLPPPERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAA
PGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYE
APEPIFTSNNSCSGLGGCPLVLGTVPVLWTLLGS
NT seq 645 nt   +upstreamnt  +downstreamnt
atggcgcccgcgcagcgcccgctgctgccgctgctgctgctgctgctcccgctgccgccg
ccgccgcccttcgcgcgcgccgaggacgccgcccgcgccaactcggaccgctacgccgtc
tactggaaccgcagcaaccccaggttccacgcgggcgcggcggacgacggcgggggctac
acggtggaggtgagcatcaacgactacctggacatctactgcccgcactacggggcgccg
ctgccgccgcccgagcgcatggagcattacgtgctgtacatggtcaacggcgagggccac
gcgtcctgcgaccaccggcagcgcggcttcaagcgctgggagtgcaaccggcccgcggcg
cccggggggccgctcaagttctccgagaagttccagctcttcacgcccttctccctcggc
ttcgagttccgccccggccacgagtactactacatctctgccacgcctcccaatgctgtg
gaccgaccctgcctgaggctgaaggtttacgttcggccgactaacgagaccctgtacgag
gcccccgagccgatcttcaccagcaataactcgtgcagtggcttgggcggctgcccgctc
gtcctcggcaccgtccccgtgctgtggaccctcctgggctcctag

KEGG   Ursus arctos horribilis: 113243198
Entry
113243198         CDS       T05909                                 

Gene name
NTF4
Definition
(RefSeq) neurotrophin-4
  KO
K12457  neurotrophin 4
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243198 (NTF4)
   04010 MAPK signaling pathway
    113243198 (NTF4)
   04151 PI3K-Akt signaling pathway
    113243198 (NTF4)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113243198 (NTF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243198 (NTF4)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113243198 (NTF4)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 113243198
NCBI-ProteinID: XP_026337495
UniProt: A0A3Q7UB65
LinkDB
Position
Unknown
AA seq 211 aa
MFPSPSCSLPILLLFLLPSVPMEPHPPPLPLPPFLAPEWDLLSPRVVLSRGAPAGPPLLF
LLEAGAFGEPAGSPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEV
LGEVPAAGGSPLRQYFFETRCKADSATEESAPGGGGGGCRGVDRRHWVSECKAKQSYVRA
LTADAQGRVGWRWIRIDTACVCTLLSRTGRA
NT seq 636 nt   +upstreamnt  +downstreamnt
atgttccccagcccctcctgctccctccccatcctcctccttttcctcctccccagtgtc
ccaatggagccccatcccccacccttaccactgcccccatttctagcccctgagtgggac
ctcctgtccccccgagtagtcctgtccaggggcgcccctgctgggccccctctgctattc
ctgctggaggccggggcctttggggagccagcaggcagccctgccaaccgcagtcggcga
ggggtgagcgagacagcaccagcaagtcgccggggagagctggctgtgtgtgatgcggtc
agtggctgggtgacagaccgccggacagccgtggacctgcgcgggcgtgaggtggaggtg
ctgggcgaggttcctgcggctggaggcagccccctccgccagtacttctttgagacccgc
tgcaaggctgacagtgccaccgaggaaagtgcccctggtgggggtgggggaggctgccgg
ggtgtggaccggaggcactgggtgtctgagtgtaaggccaagcagtcctatgtgcgggca
ttgactgctgatgcccagggccgtgtaggctggcgatggattcgaattgacactgcctgt
gtctgcacgctcctcagccggactggtcgggcctga

KEGG   Ursus arctos horribilis: 113243199
Entry
113243199         CDS       T05909                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04714  Thermogenesis
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243199 (FGF21)
   04015 Rap1 signaling pathway
    113243199 (FGF21)
   04010 MAPK signaling pathway
    113243199 (FGF21)
   04151 PI3K-Akt signaling pathway
    113243199 (FGF21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113243199 (FGF21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    113243199 (FGF21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243199 (FGF21)
  09162 Cancer: specific types
   05226 Gastric cancer
    113243199 (FGF21)
   05218 Melanoma
    113243199 (FGF21)
   05224 Breast cancer
    113243199 (FGF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243199 (FGF21)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113243199 (FGF21)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113243199 (FGF21)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113243199 (FGF21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113243199
NCBI-ProteinID: XP_026337496
UniProt: A0A3Q7TML5
LinkDB
Position
Unknown
AA seq 209 aa
MGWDEARSEQLGLWVPVLAVLLLEACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAH
LEIRADGTVVGAARRSPESLLELKALKPGVIQILGVKTSRFLCQGPDGTLYGSLHFDPVA
CSFRELLLEDGYNIYHSETLGLPLRLPAHNSPYRDLAPRGPARFLPLPGLLPVPPDPPGI
LGPEPPDVGSSDPLSMVGPSQGRSPSYAS
NT seq 630 nt   +upstreamnt  +downstreamnt
atgggctgggacgaggccaggtcggagcagctggggctgtgggtccctgtgctggctgtc
cttttgctggaagcttgccaggcacaccctatccctgactccagccccctcctccaattc
ggaggccaagttcgacagcggtacctgtacacggacgatgcccaggagacagaggcccac
ctagagatcagggctgatggcacagtggtgggggctgcccgccgcagcccagaaagtctc
ttggagctgaaagccctgaaaccgggggtcattcaaatcctgggagtgaaaacatctagg
ttcctgtgccagggcccagatgggacactgtacggatcgctccacttcgaccccgtagcc
tgcagcttccgggaactgcttctggaggatgggtacaacatctaccactccgagaccctc
ggcctcccacttcgcctgcccgcccacaactctccataccgggacttggcgccccggggg
cctgcccgcttcctgcccctgccaggcctgcttccggtccccccggaccccccagggatc
ctgggccccgagcctcccgacgtgggctcctcggaccccctgagcatggtggggccttcg
cagggccgaagtcccagctacgcttcctga

KEGG   Ursus arctos horribilis: 113243298
Entry
113243298         CDS       T05909                                 

Gene name
FLT3LG
Definition
(RefSeq) fms-related tyrosine kinase 3 ligand isoform X1
  KO
K05454  fms-related tyrosine kinase 3 ligand
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243298 (FLT3LG)
   04010 MAPK signaling pathway
    113243298 (FLT3LG)
   04151 PI3K-Akt signaling pathway
    113243298 (FLT3LG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243298 (FLT3LG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243298 (FLT3LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243298 (FLT3LG)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113243298 (FLT3LG)
SSDB
Motif
Pfam: Flt3_lig DUF4381 TMEM100
Other DBs
NCBI-GeneID: 113243298
NCBI-ProteinID: XP_026337614
UniProt: A0A3Q7V430
LinkDB
Position
Unknown
AA seq 293 aa
MIVLAPAWSPTTSLLLLLLLSPGLRGTPDCSFSHSPISSTFSVTIRKLSDYLLQDYPVTV
ASNLQDDELCGPFWRLVLAQRWMEQLKAVAGSQMQILLEAVNTEIHFVTLCALQPFPSCL
RFVQTNISHLLQDTSKHLAALKPRITRRNFSGCLELRCQPDSSTLLPPRSPGALEATALP
APQAPLLLLLLLLLPAALLLMSAAWCLRWRRRRRRRRTPYPGEQRSLRPSEMSHLPEDTE
LGLGGSQLETGPFFDGGAPLTLSPGRRQRQPPTPAPAPPIPLCTKSLSPGNCI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgatagtgctggcgccagcctggagcccaactacctccctgctgctgctgctgctgctc
agccccggcctccgcgggacccccgactgctccttcagccacagccccatctcctccacc
ttctcggtcaccatccgcaagctgtctgattacctgcttcaggactacccagtcactgtc
gcctccaacctccaggacgacgagctctgcgggccgttctggcggctggtcctggcccag
cgctggatggaacagctcaaggctgtggccgggtcccagatgcaaatcctgctggaggct
gtcaacacagagatacactttgtcaccttatgtgccttgcagcccttccccagctgtctt
cgcttcgtccagaccaacatctcccacctcctgcaggacacctccaagcacctggccgcc
ttgaagccccggatcacccgcaggaatttctctgggtgcctggagctgcggtgtcagccg
gactcttccacgctgctgcccccaaggagccccggggccttggaggccacagccctgccg
gccccccaggcccctctgctcctcctcttgctgctgctgctgcccgcggctctcctgctg
atgtccgcggcctggtgcctgcgctggcggaggcggaggcggaggcggaggacgccctac
cctggggagcagaggtcactgaggcccagcgagatgagtcacctgccagaggacacagag
ctgggacttggaggaagtcagctagagactggtcccttcttcgacggtggtgccccgctc
actctctccccaggacggaggcaacgccagcccccaacgccagccccagccccacctatc
cccctctgtacaaagtccttgtccccaggaaattgtatataa

KEGG   Ursus arctos horribilis: 113243917
Entry
113243917         CDS       T05909                                 

Gene name
FGF4
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243917 (FGF4)
   04015 Rap1 signaling pathway
    113243917 (FGF4)
   04010 MAPK signaling pathway
    113243917 (FGF4)
   04151 PI3K-Akt signaling pathway
    113243917 (FGF4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113243917 (FGF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243917 (FGF4)
  09162 Cancer: specific types
   05226 Gastric cancer
    113243917 (FGF4)
   05218 Melanoma
    113243917 (FGF4)
   05224 Breast cancer
    113243917 (FGF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243917 (FGF4)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113243917 (FGF4)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113243917 (FGF4)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113243917 (FGF4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113243917
NCBI-ProteinID: XP_026338643
UniProt: A0A3Q7UR61
LinkDB
Position
Unknown
AA seq 206 aa
MAGPGAAAAALLPAVLLAVLAPWAGRGGAAAPTAPNGTLGAELERRWESLVARSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTEECKFKEILLPNNYNAYECYRYPGMFIA
LSKNGKTKKGSRVSPTMKVTHFLPRL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcagggcccggggcggccgcggcggcgctgctcccggcggtcctgttggcggtgctg
gcgccctgggccggccgagggggcgccgccgcacccaccgcacccaacggcacgctgggg
gccgagctggaacgccgctgggagagcctggtggcgcgctcgctggcgcgcctgccggtg
gcggcgcagcccaaggaggcggccgtccagagcggcgcgggcgactacctcctgggcatc
aagcggctgcggcggctctattgcaacgtgggcatcggcttccacctccaagtgctcccc
gacggccgcatcggcggcgtgcacgcggacacgagcgacagtctgctggaactctcgccg
gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtagccatgagc
agcaagggcaagctgtacggctcgcccttcttcacggaggagtgcaagttcaaagagatc
ctccttcccaacaactacaacgcgtatgagtgctacaggtacccgggcatgttcattgcc
ctgagcaagaacggcaagaccaagaagggcagccgagtgtcccccaccatgaaggtcacc
cactttctccccaggctgtga

KEGG   Ursus arctos horribilis: 113243934
Entry
113243934         CDS       T05909                                 

Gene name
FGF3
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243934 (FGF3)
   04015 Rap1 signaling pathway
    113243934 (FGF3)
   04010 MAPK signaling pathway
    113243934 (FGF3)
   04151 PI3K-Akt signaling pathway
    113243934 (FGF3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113243934 (FGF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243934 (FGF3)
  09162 Cancer: specific types
   05226 Gastric cancer
    113243934 (FGF3)
   05218 Melanoma
    113243934 (FGF3)
   05224 Breast cancer
    113243934 (FGF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243934 (FGF3)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113243934 (FGF3)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113243934 (FGF3)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113243934 (FGF3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113243934
NCBI-ProteinID: XP_026338655
UniProt: A0A3Q7UEL1
LinkDB
Position
Unknown
AA seq 226 aa
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEMTAVEVGIVAIKGLFSGRYLAMNKRGRLYASESYNAECEFVER
IHELGYNTYASRLYRTAPSGPGAQRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHKDHEMVRLLQSEAGLRGGLPGPPGKGTRPRRQRKRSRGGRA
NT seq 681 nt   +upstreamnt  +downstreamnt
atgggcctaatctggctcctgctgctcagcctgctggagcccggctggcccgccgcgggt
cccggggcgcgactgcggcgcgatgcgggcggccgcggcggcgtctacgagcacctcggc
ggggcgccccggcgccgcaagctctactgcgccaccaagtaccacctgcagctgcacccg
agtggccgcgtcaacggcagcctggaaaacagcgcctacagtatcctggagatgacagcg
gtggaggtgggcatcgtggccatcaaggggctcttctccgggcggtacctggccatgaac
aagagggggcgactctatgcttcggagagctacaacgccgagtgtgagttcgtggagcgg
atccacgagctgggctacaacacgtacgcctcgcggctgtaccgcacagcgcccagcggc
ccgggggcccagcggcagcccagcgccgagagactgtggtatgtgtccgtgaacggcaag
ggcaggccccgcaggggcttcaagacgcgccgcacccagaagtcctccttgttcctgccc
cgcgtgctggaccacaaggaccacgagatggtgcggctgctccagagcgaggccgggctc
cgcggcggcctgcccgggcccccaggcaagggcacccggccccggcggcagaggaagcgg
agccggggaggccgtgcgtag

KEGG   Ursus arctos horribilis: 113243935
Entry
113243935         CDS       T05909                                 

Gene name
FGF19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K22603  fibroblast growth factor 19
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243935 (FGF19)
   04015 Rap1 signaling pathway
    113243935 (FGF19)
   04010 MAPK signaling pathway
    113243935 (FGF19)
   04151 PI3K-Akt signaling pathway
    113243935 (FGF19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113243935 (FGF19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243935 (FGF19)
  09162 Cancer: specific types
   05226 Gastric cancer
    113243935 (FGF19)
   05218 Melanoma
    113243935 (FGF19)
   05224 Breast cancer
    113243935 (FGF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243935 (FGF19)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113243935 (FGF19)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113243935 (FGF19)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113243935 (FGF19)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113243935
NCBI-ProteinID: XP_026338657
UniProt: A0A3Q7VL11
LinkDB
Position
Unknown
AA seq 219 aa
MRSAPSRCAVARALVLAGLCLAAAGRPLAFSDAGPHVHYGWGEPIRLRHLYTAGPHGLSS
CFLRIRADGGVDCARGQSAHSLVEIRAVALRTVAIKGVHSVRYLCMGADGRMQGLPQYSA
GDCAFEEEIRPDGYNVYRSKKHRLPVSLSSAKQRQLYKDRGFLPLSHFLPMLPGSPAEPR
ELQDHAESDGFSAPLETDSMDPFGIAAKMGLVKSPSFQK
NT seq 660 nt   +upstreamnt  +downstreamnt
atgcggagcgcgccgagccggtgcgcggtagcccgcgccctggtcctagccggcctctgc
ctggccgcagccgggcgccccctagccttctcggacgcggggccgcacgtgcactacggc
tggggtgagcccatccgcctacggcacctgtacaccgccggcccccacggcctctccagc
tgcttcctgcgcatccgtgccgacggcggggttgactgcgcgcggggccagagcgcgcac
agtttggtggagatcagggcagtcgctctgcggaccgtggccatcaagggcgtgcacagc
gtccggtacctctgcatgggcgccgacggcaggatgcaagggctgcctcagtactccgcg
ggggactgtgctttcgaggaggagatccgccccgacggctacaatgtgtaccggtccaag
aagcaccgtctccctgtctctctgagcagcgccaaacagaggcagctgtacaaggacaga
ggctttctgcccctgtcccacttcttgcccatgctgcctgggagcccagcagagcccagg
gaactccaggaccacgcggagtcggacgggttttctgcacccctagaaacagacagcatg
gacccttttgggatcgccgccaaaatgggactagtgaagagtcccagcttccagaaataa

KEGG   Ursus arctos horribilis: 113243959
Entry
113243959         CDS       T05909                                 

Gene name
IGF2
Definition
(RefSeq) insulin-like growth factor II isoform X1
  KO
K13769  insulin-like growth factor 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04151  PI3K-Akt signaling pathway
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243959 (IGF2)
   04010 MAPK signaling pathway
    113243959 (IGF2)
   04151 PI3K-Akt signaling pathway
    113243959 (IGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243959 (IGF2)
   05205 Proteoglycans in cancer
    113243959 (IGF2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113243959 (IGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243959 (IGF2)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113243959 (IGF2)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113243959 (IGF2)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113243959 (IGF2)
SSDB
Motif
Pfam: IGF2_C Insulin
Other DBs
NCBI-GeneID: 113243959
NCBI-ProteinID: XP_026338700
UniProt: A0A3Q7UEQ9
LinkDB
Position
Unknown
AA seq 184 aa
MPMGVPMGKSMLVLLTFLALASCCFAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASR
VSRRSSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYD
TWKQSAQRLRRGLPALLRARRGRMLAKELEAFREAKRHHPLIALPTHDPVAHGGASPEAS
GNQK
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgatgggggtcccgatggggaagtcgatgctggtgctgctgaccttcttggccttg
gcctcgtgctgctttgctgcttaccgccccagtgagaccctgtgcggcggggagctggtg
gacaccctccagtttgtctgtggggaccgcggcttttacttcagcaggccggcaagccgc
gtgagccgccgcagcagccgtggcatcgtggaagagtgctgcttccgcagctgtgacctg
gcccttctggagacctactgcgccacccccgccaagtccgagagggacgtgtcgacccct
ccgaccgtgcttccggacaacttccccagataccccgtgggcaagttcttccaatatgac
acctggaagcagtctgcccaacgactgcgcaggggcctgcctgccctcctgcgtgcccgc
cggggtcgcatgctcgccaaggagcttgaggcgttcagagaggccaagcgtcatcatccc
ctgatcgccctgcccacccacgaccccgtggcccacgggggcgcctctccggaggcatcc
ggcaatcagaagtga

KEGG   Ursus arctos horribilis: 113243960
Entry
113243960         CDS       T05909                                 

Definition
(RefSeq) insulin-like
  KO
K04526  insulin
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04072  Phospholipase D signaling pathway
uah04114  Oocyte meiosis
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04911  Insulin secretion
uah04913  Ovarian steroidogenesis
uah04914  Progesterone-mediated oocyte maturation
uah04917  Prolactin signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04930  Type II diabetes mellitus
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04940  Type I diabetes mellitus
uah04950  Maturity onset diabetes of the young
uah04960  Aldosterone-regulated sodium reabsorption
uah05010  Alzheimer disease
uah05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113243960
   04015 Rap1 signaling pathway
    113243960
   04010 MAPK signaling pathway
    113243960
   04066 HIF-1 signaling pathway
    113243960
   04068 FoxO signaling pathway
    113243960
   04072 Phospholipase D signaling pathway
    113243960
   04022 cGMP-PKG signaling pathway
    113243960
   04151 PI3K-Akt signaling pathway
    113243960
   04152 AMPK signaling pathway
    113243960
   04150 mTOR signaling pathway
    113243960
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113243960
  09143 Cell growth and death
   04114 Oocyte meiosis
    113243960
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113243960
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    113243960
   04910 Insulin signaling pathway
    113243960
   04923 Regulation of lipolysis in adipocytes
    113243960
   04913 Ovarian steroidogenesis
    113243960
   04914 Progesterone-mediated oocyte maturation
    113243960
   04917 Prolactin signaling pathway
    113243960
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113243960
  09149 Aging
   04211 Longevity regulating pathway
    113243960
   04213 Longevity regulating pathway - multiple species
    113243960
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    113243960
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113243960
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    113243960
   04940 Type I diabetes mellitus
    113243960
   04950 Maturity onset diabetes of the young
    113243960
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113243960
   04931 Insulin resistance
    113243960
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 113243960
NCBI-ProteinID: XP_026338704
UniProt: A0A3Q7V704
LinkDB
Position
Unknown
AA seq 109 aa
MALWTRLLPLLALLAFWAPVPARTFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVED
LPVRDARPEGVPGADPQPRALAGALQRRGIVEQCCTSICSLYQLENYCN
NT seq 330 nt   +upstreamnt  +downstreamnt
atggccctctggacgcgcctcctgcccctgctggctttgctggccttctgggcacctgtg
cccgccagaaccttcgtgaaccagcacctgtgtggctcccacctggtggaggcgctctac
ctggtgtgcggggagcgaggcttcttctacacgcccaaggcccgccgggaggtggaggac
ctgccggtgagggacgccaggccggaaggggtgcctggcgcagacccgcagccccgggcc
ctggcgggggcgctgcagaggcggggcatcgtggagcagtgctgcaccagcatctgctcg
ctctaccagctggagaattactgcaactag

KEGG   Ursus arctos horribilis: 113244181
Entry
113244181         CDS       T05909                                 

Gene name
VEGFB
Definition
(RefSeq) vascular endothelial growth factor B isoform X1
  KO
K16858  vascular endothelial growth factor B
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04926  Relaxin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113244181 (VEGFB)
   04015 Rap1 signaling pathway
    113244181 (VEGFB)
   04010 MAPK signaling pathway
    113244181 (VEGFB)
   04151 PI3K-Akt signaling pathway
    113244181 (VEGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113244181 (VEGFB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    113244181 (VEGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113244181 (VEGFB)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113244181 (VEGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113244181 (VEGFB)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113244181 (VEGFB)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 113244181
NCBI-ProteinID: XP_026339154
UniProt: A0A3Q7V895
LinkDB
Position
Unknown
AA seq 207 aa
MSPLLRRLLLAALLQLAPAQGPVSQPDALGHQKKVVSWIDVYARATCQPREVVVPLTVEL
MGSMAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
QCECRPKKRESALKPDRASTPHHRPQPRSIPGWDSVPGAPSPADITHPTPAPGPSAHAAP
SAASALTPGPAAVAADAAASSVAKGGA
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagccccctgctccgccgcctgctgctcgccgcgctcctgcagctggcccccgcccag
ggccctgtgtcccagcctgatgccctcggccaccagaagaaagtggtgtcatggatagat
gtgtatgcccgtgccacctgccagccgcgggaggtggtggtgcccctgaccgtggagctc
atgggctccatggccaagcaactggtgcccagctgcgtgacggtgcagcgctgcggtggc
tgctgccctgacgacggcctggagtgcgtgcccaccgggcagcaccaagtccgaatgcag
atcctcatgatccgttacccgagcagtcagctgggcgagatgtccctggaagaacacagc
cagtgtgaatgcagaccaaaaaagagagagagtgctctgaagccggacagggcttccact
ccccaccaccgcccccagccccgctccattccgggctgggactctgtccccggagcaccc
tccccagctgacatcacccatcccactccagccccaggcccctctgcccacgctgcaccc
agcgccgccagcgccctgaccccaggacctgccgctgtcgctgccgacgccgcagcttcc
tccgttgccaagggcggggcctag

KEGG   Ursus arctos horribilis: 113244387
Entry
113244387         CDS       T05909                                 

Gene name
NGF
Definition
(RefSeq) beta-nerve growth factor
  KO
K02582  nerve growth factor, beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04722  Neurotrophin signaling pathway
uah04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113244387 (NGF)
   04015 Rap1 signaling pathway
    113244387 (NGF)
   04010 MAPK signaling pathway
    113244387 (NGF)
   04151 PI3K-Akt signaling pathway
    113244387 (NGF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113244387 (NGF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113244387 (NGF)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113244387 (NGF)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113244387 (NGF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:uah03110]
    113244387 (NGF)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113244387 (NGF)
Chaperones and folding catalysts [BR:uah03110]
 Intramolecular chaperones
  Others
   113244387 (NGF)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113244387 (NGF)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 113244387
NCBI-ProteinID: XP_026339462
UniProt: A0A3Q7VNA9
LinkDB
Position
Unknown
AA seq 293 aa
MPAVSSYRVLARGRAVQGAGWHAAPKLSSASGPNNGFSKGAAFCPGHTEVHSVMSMLFHT
LITALLIGIQAEPHPESHVPAGHAIPQAHWTKLQHSLDTALRRARSAPAGAIAARVAGQT
RNITVDPKLFKKRRLRSPRVLFSTHPPPVATDTQDLDLEAGSASVNRTHRSKRSSSHPVF
HRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPTPVDSG
CRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA
NT seq 882 nt   +upstreamnt  +downstreamnt
atgccagctgtctcatcctacagagtcctggcccgtggtcgtgcagtccagggggctgga
tggcatgctgcacccaagctcagctcagcgtccgggcccaataacggcttttccaaggga
gcagctttctgtcctggccacaccgaggtgcatagcgtaatgtccatgttgttccatact
ctgatcacagctcttttgatcggcatccaggcagaaccccatcccgagagccatgtccca
gcaggacacgccatcccccaagcccactggactaagcttcagcattcccttgacacagcc
ctccgcagagcccgcagcgccccggcgggggcgatagctgccagggtggcagggcagacc
cgcaacatcactgtggaccccaaactctttaaaaagcggcgactgcgctcaccccgcgtg
ctgttcagcacgcaccccccacctgtggctacagatactcaggatctggacttggaggcc
ggcagtgcctcggtcaacaggactcacaggagcaagcggtcgtcatcccaccctgtcttc
caccggggggagttctcggtgtgcgacagcgtcagcgtgtgggtgggggacaagaccacc
gccacggacatcaagggcaaggaggtgatggtgctgggagaggtgaacattaacaacagt
gtgttcaaacagtacttttttgagaccaagtgccgggaccccactcccgtggacagcggg
tgcaggggcattgactcgaagcactggaactcatactgtaccacgacccataccttcgtc
aaggcgctgaccatggacggcaagcaggctgcctggcggtttatccggatcgacacagcc
tgtgtgtgcgtgctcagcaggaaggctgggagaagagcctga

KEGG   Ursus arctos horribilis: 113244914
Entry
113244914         CDS       T05909                                 

Gene name
CSF1
Definition
(RefSeq) macrophage colony-stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04151  PI3K-Akt signaling pathway
uah04380  Osteoclast differentiation
uah04640  Hematopoietic cell lineage
uah04668  TNF signaling pathway
uah05010  Alzheimer disease
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113244914 (CSF1)
   04015 Rap1 signaling pathway
    113244914 (CSF1)
   04010 MAPK signaling pathway
    113244914 (CSF1)
   04668 TNF signaling pathway
    113244914 (CSF1)
   04151 PI3K-Akt signaling pathway
    113244914 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113244914 (CSF1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113244914 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113244914 (CSF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113244914 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113244914 (CSF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113244914 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113244914 (CSF1)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113244914 (CSF1)
SSDB
Motif
Pfam: CSF-1
Other DBs
NCBI-GeneID: 113244914
NCBI-ProteinID: XP_026340395
UniProt: A0A3Q7UJN6
LinkDB
Position
Unknown
AA seq 559 aa
MTARGAAGRCPPTTWLKPLLLLVCLLASGSITEEVSERCSHMIGNGHLQFLQELIDSQME
TSCQIAYEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNAIVIVKLQELSLRLK
SCFTKDYDEQDKACVRTYYETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNNSFAKCSS
QDVVTKPDCNCLYPKATPSSDLASVSPQQPLAPSMAPMAGLTWADSEGTEGSSLLPSEQP
LRTVDLDPRSAKQRPPRSTCQSFESPEPPGVEASPVVGDSPQPRPSVGAPVPGMEDILDS
ALGTNWTLEEASGEASEVPVPQGAALSSSRLGGGRVQAETTAGPSDLSSAPFPQSYSARG
EQPEDMTGVPLPTVGPARPTGQAQSHTPEKTDRPSAPPRDHQEPSSARTPSRPPRGLRSP
SALSAQPNLPRRHSWGHVLPLGELEGRRSTRDRRSPTELEGRRASEGAAGAPAPFNSVPL
TDTGHERQQEGPSDPQLRGFTFHLLVPSITLLLLAVGGLLFYRWRRRSHREPQTADSPME
KPEGSPLTQDEDRQVELPV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgccgggcgctgccctcccacgacatggctgaagcccctgctg
ctgctggtctgtctcctggcgagcgggagcattaccgaggaggtgtcagagcgctgtagc
cacatgattgggaacggacacctgcagttcctccaggagctgatcgatagtcagatggag
acttcctgccagatcgcctatgagtttgtagaccaggaacagctgaaagatcccgtgtgc
tacctgaagaaggcgtttctcctggtacaagacataatggaagacaccatgcgcttcaaa
gacaatactcccaacgccattgttatcgtgaagctccaggaactctctctgaggctgaag
agctgcttcaccaaggactatgacgagcaggacaaggcctgtgtccgaacttactatgag
acacccctgcagttgctggaaaagatcaagaatgtctttaatgaaacaaagaatctcctg
aaaaaggactggaacgttttcagcaagaactgcaacaacagctttgctaagtgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccacccctagcagt
gacctggcctctgtctcccctcagcagccccttgccccctccatggcccctatggctggc
ttgacctgggctgactctgaggggacagaaggcagctccctcttgcccagtgagcagccc
ctccgcacagtggacctggacccgcgaagtgccaagcagcgaccacccaggagcacctgc
cagagctttgaatcccctgagcccccaggggtggaggccagccccgtcgtcggagattca
cctcagccccggccctctgtcggggcccccgtccctgggatggaagacattcttgactct
gcattgggcactaactggaccctagaagaggcctccggagaggctagtgaggttcccgta
ccccaaggggcagcgctttcttcctccaggctgggaggaggcagagtccaggccgagacg
accgccgggcccagtgacctctcgtcagcaccttttccacagtcctactcagccaggggc
gagcagccagaggacatgacgggcgtacccctgcccacagtgggccccgcaagacccact
ggccaggcccagagtcacacacctgagaagacagaccgtccatctgccccgcccagagac
caccaggagccaagctctgccaggaccccgtcgcggcccccacgaggcctcaggagtccc
tcagccctctctgcacagccaaaccttcccagaaggcactcctggggccatgtgctgccc
ctcggggagctggagggcagaaggagcaccagggatcgaaggagccccacagagctggaa
ggaagacgagcaagtgagggggcggccggggccccggccccttttaactccgttcctttg
actgacacaggccatgagaggcagcaggagggaccctctgaccctcagctccgcgggttt
accttccacctgctggtgcccagcatcaccctgctcctgctggccgtcggcggcctcctg
ttctacaggtggagacggcggagccaccgagagcctcagacagcggattctcccatggag
aaaccagagggcagccccctgacccaggatgaggacagacaggtggaactgccagtgtag

KEGG   Ursus arctos horribilis: 113245152
Entry
113245152         CDS       T05909                                 

Gene name
EFNA3
Definition
(RefSeq) ephrin-A3
  KO
K05462  ephrin-A
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04360  Axon guidance
uah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113245152 (EFNA3)
   04015 Rap1 signaling pathway
    113245152 (EFNA3)
   04010 MAPK signaling pathway
    113245152 (EFNA3)
   04151 PI3K-Akt signaling pathway
    113245152 (EFNA3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    113245152 (EFNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    113245152 (EFNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113245152 (EFNA3)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113245152 (EFNA3)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113245152 (EFNA3)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   113245152 (EFNA3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 113245152
NCBI-ProteinID: XP_026340826
UniProt: A0A3Q7TXX4
LinkDB
Position
Unknown
AA seq 238 aa
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSHAGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHSLHWKCLRMKVFVCCASTSHSGEKPAPT
LPQFTMGPHVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTLLAS
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggcggctccgctgctgctgctgctgctgctcgtgcccgtgccgctgctgccgctg
ctggcccaggggcccgggggggcgctgggaaaccggcatgcggtgtactggaacagctcc
aaccagcacctgcgacgagagggctacacggtgcaggtgaatgtgaacgattacctggat
atttactgccctcactacaacagctcgggggtgggccccggggcggggccgggccccggg
ggcggggcagagcagtacgtgctgtacatggtgagccacgccggctaccgcacctgcaac
gccagccaaggcttcaagcgctgggagtgcaaccgcccgcacgccccccacagccccatc
aagttctcggagaagttccagcgctacagcgccttctcgctgggctacgagttccacgcc
ggccacgagtactactacatctccacgcccacccacagcctgcactggaagtgtctgagg
atgaaggtgttcgtctgctgcgcctccacatcgcactccggggagaagccggcccccacc
ctcccccagttcaccatgggcccccatgtgaagatcaacgtgctggaagactttgaggga
gagaatccccaggtgcccaagcttgagaagagcatcagcgggaccagccccaagagggaa
cacctgcccctggcggtgggcatcgccttcttcctcatgacactcttggcctcctag

KEGG   Ursus arctos horribilis: 113245285
Entry
113245285         CDS       T05909                                 

Gene name
EFNA1
Definition
(RefSeq) ephrin-A1
  KO
K05462  ephrin-A
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04360  Axon guidance
uah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113245285 (EFNA1)
   04015 Rap1 signaling pathway
    113245285 (EFNA1)
   04010 MAPK signaling pathway
    113245285 (EFNA1)
   04151 PI3K-Akt signaling pathway
    113245285 (EFNA1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    113245285 (EFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    113245285 (EFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113245285 (EFNA1)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113245285 (EFNA1)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113245285 (EFNA1)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   113245285 (EFNA1)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 113245285
NCBI-ProteinID: XP_026341034
UniProt: A0A3Q7VDN2
LinkDB
Position
Unknown
AA seq 205 aa
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRDEDYTVHVRLNDYLDIICPHYEDDAVA
DAAMERYTLYLVEREQYQLCQPQSKDQVRWQCNQPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIHRQEDECLRLKVTVDGKITHSPQAHAIPQEKRLPADDPEVQVLHSIG
HSAAPRLFPLAWAVLLLPFLLLQAP
NT seq 618 nt   +upstreamnt  +downstreamnt
atggagttcctctgggccccgctcttgggtctgtgctgcagtctggccgctgctgaccgc
cacaccgtcttctggaacagttcaaaccccaagttccgggatgaggactacacggtacac
gtgcggctgaatgactacctggatatcatctgtccgcattatgaggatgacgccgtggcg
gacgctgccatggagcggtacaccctgtacctggtggagcgcgagcagtaccaactgtgc
cagccccagtccaaggaccaggtccgctggcagtgcaaccagcccagcgccaagcatggc
ccggagaagctgtcggagaaattccagcgcttcacgcccttcaccctgggcaaggagttc
aaggagggacacagctactactatatctccaaacccatccaccgccaggaagacgagtgc
ttgaggttgaaggtgactgttgatggcaaaatcactcacagtcctcaggcccatgccatt
ccacaggagaagagacttccggcagatgacccagaagtacaggtcctacatagcatcggt
cacagtgctgcccctcgcctcttcccacttgcctgggctgtgctgctcctgccgttcctg
ctgctgcaggccccatga

KEGG   Ursus arctos horribilis: 113245292
Entry
113245292         CDS       T05909                                 

Gene name
EFNA4
Definition
(RefSeq) ephrin-A4
  KO
K05462  ephrin-A
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04360  Axon guidance
uah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113245292 (EFNA4)
   04015 Rap1 signaling pathway
    113245292 (EFNA4)
   04010 MAPK signaling pathway
    113245292 (EFNA4)
   04151 PI3K-Akt signaling pathway
    113245292 (EFNA4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    113245292 (EFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    113245292 (EFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113245292 (EFNA4)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113245292 (EFNA4)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113245292 (EFNA4)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   113245292 (EFNA4)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 113245292
NCBI-ProteinID: XP_026341059
UniProt: A0A3Q7VDR1
LinkDB
Position
Unknown
AA seq 204 aa
MRLLPLLRTVLWAALLSSPLRGGSGLRHAVYWNSSNPRLLGGDGLVELDLNDYLDIFCPH
YEGPGPPDGPETFALYMVDRPGYEACQAQGPGAFKRWECALPFAPFGPVRFSEKIQRFTP
FSLGFEFLPGETYYYISVPTPESSGKCLRLQVSVCCKESRSESAHPVGSPGESGTSGWQG
GGALSPLCLLLLLLLPILRLLRVL
NT seq 615 nt   +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtcctctgggccgcgctcctcagctccccgctg
cgagggggctccggcctccgccacgctgtctactggaactccagtaaccccaggctgctg
ggaggagacggcctggtggagctggacctcaacgattacctagacatcttctgcccgcac
tatgaggggcccgggccccctgacggccccgagacgttcgctttgtatatggtggaccgg
ccaggctatgaggcctgccaggcccaggggccgggtgccttcaagcgctgggagtgtgcg
ctccccttcgctcccttcggccctgttcgattctctgagaagattcagcgcttcacaccc
ttctcgcttggctttgagttcttgcctggagagacctactactacatctcggtaccaact
ccggagagttctggcaagtgcttgaggctccaggtgtctgtctgctgcaaggagagcagg
tcggagtcagcccaccccgttggaagccctggagagagcggcacatcagggtggcaaggg
ggaggcgccctcagccccctctgtctcttgctgctgttgctgctcccaattctgcgtctc
ctgcgagttctctga

KEGG   Ursus arctos horribilis: 113248512
Entry
113248512         CDS       T05909                                 

Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04630  Jak-STAT signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05206  MicroRNAs in cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05231  Choline metabolism in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113248512
   04015 Rap1 signaling pathway
    113248512
   04010 MAPK signaling pathway
    113248512
   04630 Jak-STAT signaling pathway
    113248512
   04072 Phospholipase D signaling pathway
    113248512
   04151 PI3K-Akt signaling pathway
    113248512
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113248512
   04540 Gap junction
    113248512
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113248512
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113248512
   05202 Transcriptional misregulation in cancer
    113248512
   05206 MicroRNAs in cancer
    113248512
   05231 Choline metabolism in cancer
    113248512
  09162 Cancer: specific types
   05214 Glioma
    113248512
   05218 Melanoma
    113248512
   05215 Prostate cancer
    113248512
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113248512
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113248512
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113248512
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113248512
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113248512
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113248512
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 113248512
NCBI-ProteinID: XP_026345789
UniProt: A0A3Q7V1V0
LinkDB
Position
Unknown
AA seq 211 aa
MRTWACLLLLGCGYLAHALAEEAEIPREVIERLARSHIYSIRDLQRLLEIDSVGAEDALE
ASLRAHGGHASKRAPEKRPMPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCAGCCNTSSVKCQPSRVHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECTCT
ASGLNPDHREEETGRRRESGKKRKRKRLKPT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctactcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagatcccccgcgaggtgattgagaggctggcgcgcagtcacatctacagc
atccgggacctccagcgactcctggagatagactccgtaggggccgaggatgctttggaa
gcgagtctgagagcccacgggggccatgccagcaagcgtgcacccgagaagaggcccatg
cccatccgaaggaaaagaagcatcgaggaagccatcccggcggtctgcaagaccaggacg
gtcatttatgagatacctcggagccaggtcgaccccacgtctgccaacttcctgatctgg
cccccgtgcgtggaggtgaagcgctgtgccgggtgctgtaacaccagcagcgtcaagtgc
cagccctcccgcgtccaccaccgcagcgtcaaggtggccaaggtggagtacatcaggaag
aagccgaagttgaaagaagtgcaggtgcgtctggaggaacatctggaatgcacgtgcacg
gccagcgggctgaacccggaccaccgggaggaggagacgggaaggcgtagggagtcaggt
aaaaaacggaaaagaaaaaggttaaagcccacctaa

KEGG   Ursus arctos horribilis: 113248525
Entry
113248525         CDS       T05909                                 

Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04630  Jak-STAT signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05206  MicroRNAs in cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05231  Choline metabolism in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113248525
   04015 Rap1 signaling pathway
    113248525
   04010 MAPK signaling pathway
    113248525
   04630 Jak-STAT signaling pathway
    113248525
   04072 Phospholipase D signaling pathway
    113248525
   04151 PI3K-Akt signaling pathway
    113248525
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113248525
   04540 Gap junction
    113248525
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113248525
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113248525
   05202 Transcriptional misregulation in cancer
    113248525
   05206 MicroRNAs in cancer
    113248525
   05231 Choline metabolism in cancer
    113248525
  09162 Cancer: specific types
   05214 Glioma
    113248525
   05218 Melanoma
    113248525
   05215 Prostate cancer
    113248525
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113248525
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113248525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113248525
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113248525
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113248525
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113248525
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 113248525
NCBI-ProteinID: XP_026345815
UniProt: A0A3Q7V1V0
LinkDB
Position
Unknown
AA seq 211 aa
MRTWACLLLLGCGYLAHALAEEAEIPREVIERLARSHIYSIRDLQRLLEIDSVGAEDALE
ASLRAHGGHASKRAPEKRPMPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCAGCCNTSSVKCQPSRVHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECTCT
ASGLNPDHREEETGRRRESGKKRKRKRLKPT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctactcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagatcccccgcgaggtgattgagaggctggcgcgcagtcacatctacagc
atccgggacctccagcgactcctggagatagactccgtaggggccgaggatgctttggaa
gcgagtctgagagcccacgggggccatgccagcaagcgtgcacccgagaagaggcccatg
cccatccgaaggaaaagaagcatcgaggaagccatcccggcggtctgcaagaccaggacg
gtcatttatgagatacctcggagccaggtcgaccccacgtctgccaacttcctgatctgg
cccccgtgcgtggaggtgaagcgctgtgccgggtgctgtaacaccagcagcgtcaagtgc
cagccctcccgcgtccaccaccgcagcgtcaaggtggccaaggtggagtacatcaggaag
aagccgaagttgaaagaagtgcaggtgcgtctggaggaacatctggaatgcacgtgcacg
gccagcgggctgaacccggaccaccgggaggaggagacgggaaggcgtagggagtcaggt
aaaaaacggaaaagaaaaaggttaaagcccacctaa

KEGG   Ursus arctos horribilis: 113251181
Entry
113251181         CDS       T05909                                 

Gene name
FGF9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113251181 (FGF9)
   04015 Rap1 signaling pathway
    113251181 (FGF9)
   04010 MAPK signaling pathway
    113251181 (FGF9)
   04151 PI3K-Akt signaling pathway
    113251181 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113251181 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113251181 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    113251181 (FGF9)
   05218 Melanoma
    113251181 (FGF9)
   05224 Breast cancer
    113251181 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113251181 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113251181 (FGF9)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113251181 (FGF9)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113251181 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113251181
NCBI-ProteinID: XP_026348773
UniProt: A0A3Q7VI96
LinkDB
Position
Unknown
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg
aatgtgcccgtgttgccggtggacagtccggttttgttaagtgaccacctgggtcagtcc
gaagcaggggggcttcccaggggacccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt
actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag
aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttt
gaagaaaactggtataacacatactcctcgaatctatataaacacgtggacactggaagg
cgatactatgttgcattaaataaagacgggaccccaagagaaggaacgaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaacta
tataaggatattctaagccaaagttga

KEGG   Ursus arctos horribilis: 113251656
Entry
113251656         CDS       T05909                                 

Gene name
FGF8
Definition
(RefSeq) fibroblast growth factor 8 isoform X1
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113251656 (FGF8)
   04015 Rap1 signaling pathway
    113251656 (FGF8)
   04010 MAPK signaling pathway
    113251656 (FGF8)
   04151 PI3K-Akt signaling pathway
    113251656 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113251656 (FGF8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113251656 (FGF8)
  09162 Cancer: specific types
   05226 Gastric cancer
    113251656 (FGF8)
   05218 Melanoma
    113251656 (FGF8)
   05224 Breast cancer
    113251656 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113251656 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113251656 (FGF8)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113251656 (FGF8)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113251656 (FGF8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 113251656
NCBI-ProteinID: XP_026349434
UniProt: A0A3Q7W453
LinkDB
Position
Unknown
AA seq 215 aa
MGSPRSALSCLLLHLLVLCLQAQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRT
SGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKS
NGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPR
GHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctcggcgctgagctgcctgctgttgcacttgctggttctctgcctc
caagcccaggtaactgttcagtcctcacctaattttacacagcatgtgagggagcagagc
ctggtgacggatcagctcagccgccgcctcatccggacctaccagctctacagccgcacc
agcgggaagcacgtgcaggtcctggccaacaagcgcatcaacgccatggcagaagacggg
gaccccttcgcaaagctcattgtggagacagatacctttgggagccgggttcgagtccgc
ggagctgagactggcctctacatctgcatgaataagaaggggaagctgatcgccaagagc
aacggcaagggcaaggactgcgtgttcacggagatcgtgctggagaacaactacacggcc
ctgcagaacgccaagtacgagggctggtacatggccttcacccgcaagggccggccgcgc
aagggctccaagacgcggcagcaccagcgcgaggtgcacttcatgaagcggctgccgcgc
ggccaccacaccacggagcagagcctgcgcttcgagttcctcaactacccgccgttcacg
cgcagcctgcgcggcagccagaggacttgggcccccgagccccggtag

KEGG   Ursus arctos horribilis: 113252830
Entry
113252830         CDS       T05909                                 

Gene name
ANGPT1
Definition
(RefSeq) angiopoietin-1 isoform X1
  KO
K05465  angiopoietin 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04066  HIF-1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113252830 (ANGPT1)
   04015 Rap1 signaling pathway
    113252830 (ANGPT1)
   04010 MAPK signaling pathway
    113252830 (ANGPT1)
   04066 HIF-1 signaling pathway
    113252830 (ANGPT1)
   04151 PI3K-Akt signaling pathway
    113252830 (ANGPT1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113252830 (ANGPT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113252830 (ANGPT1)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113252830 (ANGPT1)
SSDB
Motif
Pfam: Fibrinogen_C
Other DBs
NCBI-GeneID: 113252830
NCBI-ProteinID: XP_026351354
UniProt: A0A3Q7W9X5
LinkDB
Position
Unknown
AA seq 498 aa
MTVLLSLAFLAAILTHVGCSNQRRGPENGGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKIENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEERENLQVLVTRQTYIIQELEKQLNRA
TNNNSFLQKQQLELMDTVHNLVNLCTKEGVLLKGGKKEEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDLNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYTLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaccgttctcctttcccttgctttcctcgctgccattctgactcacgtagggtgcagc
aaccagcgccggggtccagaaaacggggggagaagatataaccggattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgacgggaactgtcgtgagagtacgacagac
cagtacaacacaaacgctctgcagcgagatgctccacacgtggaaccggatttctcttcc
cagaaacttcaacatctggagcatgtgatggaaaattatactcagtggctgcaaaaaatt
gagaactacattgtggaaaatatgaagtcggagatggcccagatacagcagaatgctgtg
cagaaccacacggccaccatgctcgagataggaaccagcctcctctctcagaccgcagag
cagaccagaaagctgacagatgttgagacccaggtactaaatcaaacttctcgacttgaa
atacaactgctagagaattcgttatcaacatacaagctagagaagcagcttcttcaacag
acaaatgaaatcctaaagattcatgagaaaaacagtttattagaacataaaatcttagaa
atggagggaaagcacaaggaagagttggacaccttaaaagaagagagagaaaatcttcaa
gtcttggttactcgtcaaacatatataatccaggaactggagaaacagttgaacagagcc
accaacaataatagtttccttcagaagcagcagctggagctgatggacacagtgcataac
ctcgtcaacctttgcactaaagaaggtgttttactaaagggaggaaaaaaagaggaagag
aaaccatttagagactgtgcagatgtatatcaagctggttttaataaaagtggaatctac
actatttatattaataatatgccagaacccaaaaaggtattttgcaatatggatcttaat
ggaggaggttggactgtaatacaacatcgtgaagatggaagtctagatttccaaagaggt
tggaaagaatataaaatgggttttggaaatccctctggcgaatattggctggggaacgag
tttatttttgccataaccagtcagaggcagtacacactaagaatcgagttaatggattgg
gaaggaaaccgagcctattcacaatatgacagattccacataggaaacgagaagcagaac
tacaggttgtatttaaagggtcacactgggacagcaggaaaacagagcagcctgatctta
catggtgctgatttcagcactaaagatgcagataatgacaactgtatgtgcaaatgtgcc
ctcatgctaacaggaggctggtggtttgatgcttgtggcccctccaatctaaatggaatg
ttttacactgctggacaaaaccacggaaaactgaatgggataaagtggcactacttcaaa
gggcccagttactccttacgttctacaacgatgatgattcgacctttggacttttga

KEGG   Ursus arctos horribilis: 113255018
Entry
113255018         CDS       T05909                                 

Gene name
EFNA5
Definition
(RefSeq) ephrin-A5 isoform X1
  KO
K05462  ephrin-A
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04360  Axon guidance
uah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113255018 (EFNA5)
   04015 Rap1 signaling pathway
    113255018 (EFNA5)
   04010 MAPK signaling pathway
    113255018 (EFNA5)
   04151 PI3K-Akt signaling pathway
    113255018 (EFNA5)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    113255018 (EFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    113255018 (EFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255018 (EFNA5)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113255018 (EFNA5)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113255018 (EFNA5)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   113255018 (EFNA5)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 113255018
NCBI-ProteinID: XP_026354277
UniProt: A0A3Q7WV13
LinkDB
Position
Unknown
AA seq 228 aa
MLHVEMLTLVFLVLWMCVLSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctggtgtttctggtgctctggatgtgtgtgctcagc
caggacccaggctccaaggccgtcgccgaccgctacgccgtctactggaacagcagcaac
cccagattccagagaggtgactaccacattgacgtctgtatcaatgactacctggatgtt
ttctgccctcactatgaggactcggtcccggaagataagactgagcgttatgtcctctac
atggtgaactttgacggctacagcgcctgcgaccatacttccaaagggttcaagagatgg
gaatgtaaccggccccactctcccaatggaccgctgaagttctccgaaaaattccagctc
ttcacacccttttctctaggatttgaattcaggccaggccgggaatatttctacatctcc
tctgcaatcccagataatggcagaaggtcctgtctcaagctcaaagtctttgtgagacca
acaaatagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggtgagaacgcggcacaaacaccaaggatacccagccgccttttggcaatcctactgttc
ctcctggcgatgcttttgacgttatag

KEGG   Ursus arctos horribilis: 113255360
Entry
113255360         CDS       T05909                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04390  Hippo signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113255360 (FGF1)
   04015 Rap1 signaling pathway
    113255360 (FGF1)
   04010 MAPK signaling pathway
    113255360 (FGF1)
   04390 Hippo signaling pathway
    113255360 (FGF1)
   04151 PI3K-Akt signaling pathway
    113255360 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113255360 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255360 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    113255360 (FGF1)
   05218 Melanoma
    113255360 (FGF1)
   05224 Breast cancer
    113255360 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255360 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113255360 (FGF1)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113255360 (FGF1)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113255360 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 113255360
NCBI-ProteinID: XP_026354806
UniProt: A0A3Q7V0K5
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPAGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTANEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcaccgccctgacggagaagtttaatctgcctgcg
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggacgggacgagggacaggagcgaccagcacattcaactgcag
ctcagtgcggaaagcgtaggggaggtgtacataaagagcaccgagaccggccagtacttg
gccatggacaccgatgggcttttgtacggctcacagacagcaaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcggagaag
aattggtttgttggtctcaagaagaacggaagctgcaaacgtggtcctcggactcactat
ggccagaaagcaattctgtttctccccctgccagtctcctctgattaa

KEGG   Ursus arctos horribilis: 113255562
Entry
113255562         CDS       T05909                                 

Gene name
EGF
Definition
(RefSeq) LOW QUALITY PROTEIN: pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04630  Jak-STAT signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05160  Hepatitis C
uah05165  Human papillomavirus infection
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05219  Bladder cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05226  Gastric cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113255562 (EGF)
   04015 Rap1 signaling pathway
    113255562 (EGF)
   04010 MAPK signaling pathway
    113255562 (EGF)
   04012 ErbB signaling pathway
    113255562 (EGF)
   04630 Jak-STAT signaling pathway
    113255562 (EGF)
   04066 HIF-1 signaling pathway
    113255562 (EGF)
   04068 FoxO signaling pathway
    113255562 (EGF)
   04072 Phospholipase D signaling pathway
    113255562 (EGF)
   04151 PI3K-Akt signaling pathway
    113255562 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113255562 (EGF)
   04540 Gap junction
    113255562 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113255562 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255562 (EGF)
   05231 Choline metabolism in cancer
    113255562 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113255562 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113255562 (EGF)
   05212 Pancreatic cancer
    113255562 (EGF)
   05226 Gastric cancer
    113255562 (EGF)
   05214 Glioma
    113255562 (EGF)
   05218 Melanoma
    113255562 (EGF)
   05219 Bladder cancer
    113255562 (EGF)
   05215 Prostate cancer
    113255562 (EGF)
   05213 Endometrial cancer
    113255562 (EGF)
   05224 Breast cancer
    113255562 (EGF)
   05223 Non-small cell lung cancer
    113255562 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    113255562 (EGF)
   05165 Human papillomavirus infection
    113255562 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113255562 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255562 (EGF)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113255562 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 Tme5_EGF_like S1FA Tr-sialidase_C
Other DBs
NCBI-GeneID: 113255562
NCBI-ProteinID: XP_026354969
UniProt: A0A3Q7WLD1
LinkDB
Position
Unknown
AA seq 1210 aa
MLLFLIILLPVVFQCSFASLSVLQRWNCPGGSPSGRGNSTCVGPAPFLIFSHGSSIFRID
LGGTNHEQLVADAGVSVIMDFHYNEGRIYWVDLERKLLQRVFLNGTRQESICNIEKNVSG
MAVNWINEELIWSNQQEGIITVTDMKGNNSRVLLSALNYPANVAIDPVERFIFWSSEVAG
SLHRADLNGVEEKILLKTSARITAVSLDVLDKRLFWIQYNRDESNSYICSCNYDGGSVHF
SKHLTQHNLFAVSLFGDRIFYSAWKKKTIWIANKHTGKDMVKINLDPSLVPPGGIKVVHP
LLQPKAERGTQAPDQKLCKWRKGNCRGGMCGQDSKSHLCTCAEGYTLSQDGKYCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFILLPDGKRCHQLISCPSNTSKCSHDCVLTSDGPV
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCLPLSPVSWECGCFPGYDLQLDKKSCVASG
PQPFLLFANSQDIRRMHFDGTDYGTLLSQQMGMVFALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEAVDVPEGLAIDWIDRKFYWTDRGKSFIEGSDLSGKHREIIIKEDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGIGRLVIASSNLVWPSGITIDYLTDKLYWCD
AKLSVIEMANLDGSKRQRLAQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGAQPCLHQNGGCEHICKERFGTAQCLCREGFVKAPDGKMC
LALNGHQIPAGNEADQVTPLDVLSRNRGFEDNITESQHLLVAEIMVSDADDCGPVGCSTR
AQCVSEGDNATCQCLKGFTGDGKLCFDIDECETGTTVCPPTSSKCVNTEGGYVCRCSEGY
RGDGIHCLDINECQLGMHTCGENATCTNTEGNYTCMCAGSLSEPGRICADSTPPSHLMED
GRHSVRNTYRECPSSYEGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLTWELRHA
GQGRQWQVTVVAVCVVGLVLLLLLGLWGAHCYRTKKLPSKNLKNPYEESSREVSSSRPTD
SEARMASCPQPWFVVIKEHQNLRNGSQPMAVKDGEVADVSQSSSLEPGSVQQTSWRNEPQ
VSMGAEQGCHPPPSSDRGSGPQAMEQSFPLPSYGARPIALGIEKPHSLLSGNPYXQQRAP
DPPHQKKRTW
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgctgctcttcctcatcattctgttgccggtagtttttcagtgtagttttgctagtctc
tcagtcctgcaacgctggaactgtcctggaggctctccctcaggaagggggaattctact
tgtgtgggtcctgcacccttcttgattttctcccatggaagcagtatctttaggattgac
ctgggaggaactaatcatgagcaattggtggcagatgctggcgtatcagtgatcatggat
tttcattacaatgagggaagaatctattgggtagatttagagagaaaacttttgcaaaga
gtttttctgaatgggacaaggcaagagagcatatgcaatatagagaaaaatgtttcagga
atggcagtaaattggataaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaacaattcccgagttctcttaagcgccttaaattatcct
gcaaatgtagcaattgatccagtggaaaggtttatattttggtcgtcagaggtggctggc
agccttcacagagccgatctcaacggtgtggaagagaagattctgttaaagacgtcagca
agaataacagctgtgtcattggatgtgcttgataagcggcttttttggattcagtacaac
agagatgaaagcaattcttatatttgttcctgtaattatgatggaggttctgtccatttt
agcaaacatctcacacagcacaatttgtttgcagtgtccctttttggtgatcggatcttc
tattcagcatggaaaaagaagacaatttggatagctaacaaacacaccgggaaggatatg
gttaaaattaacctcgacccatcgcttgtaccacctggcggaatcaaagtagtgcatccg
ctcttgcagcccaaggcagagaggggtactcaggcacctgatcagaaactctgcaaatgg
aggaaaggtaactgcagaggcggcatgtgtggtcaagactcgaagtcccatctgtgcaca
tgtgcagaaggatatactttaagccaagatggaaagtactgtgaagatgtcaatgaatgt
gccttttggaaccatggctgtactcttgggtgtgaaaacatccctggatcttattattgc
acatgtcctgtaggatttattctgcttcctgatgggaaacggtgtcatcaattaatttcc
tgtccaagcaatacttctaaatgtagccatgactgtgttctgacatcagatggtcctgta
tgtttctgtcctgaaggctcagtgcttgagacagatggaaaaacatgtagtggctgttcc
tcacctgataatggtggatgcagccagctctgcctccctctcagccctgtctcctgggag
tgtggttgctttcctgggtatgacctccaactggacaagaaaagctgtgtggcgtcagga
ccacagccatttttgctgtttgctaattctcaagatattcgacgcatgcattttgatgga
acagattatggaaccctgctcagccagcaaatgggaatggtttttgcccttgatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaagcagtagatgtgcctgaaggtctt
gccatcgattggattgaccgtaaattctactggacagacagagggaaatctttcattgaa
gggagtgatttaagtggaaaacatcgtgaaataatcatcaaggaggacatctctcagcca
cgaggaattgctgtccatccaatggccaagagattattctggactgatatggggattaat
ccacgaattgaaagttcttctcttcaaggcattggccgactggttatagctagttccaat
ctggtctggcccagtggaataacaattgattacttaactgacaaattgtattggtgtgat
gccaagctgtctgtgatcgaaatggccaatctggatggttcaaaacgccaaaggcttgcc
cagaacgatgtagggcacccctttgctgtggctgtgtttgaggatcatgtgtggttctcg
gattggactatgccatcggtaataagggtgaacaagaggactggcaaaaatagggtacgt
ctccgaggcagcatgctgaagccttcatcactggttgtagttcatccattggcaaaacca
ggagcacagccctgcttacatcaaaatggaggctgtgaacatatttgcaaagagaggttt
ggaactgctcagtgtttgtgtcgcgaaggttttgtgaaagccccagatgggaaaatgtgt
ctggctctgaatggccatcagataccggcaggtaatgaagcagatcaagtaacaccattg
gacgtcttatccaggaacagaggatttgaagataacattacagaatctcagcatttgcta
gtggctgaaatcatggtatcagatgctgatgactgcggtcctgtgggatgcagtacacga
gctcagtgtgtttcagagggagacaatgccacatgtcagtgtttgaaaggatttactggg
gatggaaaactatgttttgatatagatgaatgtgagacgggcaccacagtttgccctcct
acctcctctaagtgtgtcaataccgaaggcggctatgtctgccggtgctcagaaggctac
cgaggcgatgggattcactgtcttgatattaatgagtgccaattgggcatgcacacctgt
ggggaaaatgccacctgtacaaatacggaggggaactacacctgcatgtgtgctggcagc
ctgtctgaacctgggcggatatgcgctgactctactccgccttctcatctcatggaagat
ggccgccattctgtgagaaatacttaccgggaatgcccctcatcctatgagggctactgc
ctctataacggtgtgtgtatgtacatcgaagcagttgacagatacgcatgcaactgtgtc
tttggctacgtcggggagcgatgtcagcaccgagacttgacgtgggaactgcgccacgct
ggccaggggaggcagtggcaagtcaccgtggtggctgtctgcgtggtggggctcgtcctg
ctgctgctgctggggctgtggggcgcccactgctacaggactaagaagctgccatcaaaa
aatttaaagaatccttacgaagagtcaagcagagaagttagcagtagcaggcctacagac
agcgaggccaggatggcctcttgtccccagccttggtttgtggtgataaaggaacaccaa
aatctcaggaatggaagtcaacctatggctgtcaaggacggtgaggtagcagatgttagc
cagtcctcctctctggagccaggctcagtgcaacagacgtcatggagaaatgaaccccag
gtgtctatgggcgcagagcaaggctgccaccctccaccatccagtgatagaggctctggt
ccccaggcaatggagcagagctttcctctcccctcctatggggcacggcccattgctttg
gggatcgagaagccccattctctcctgtcaggtaacccttatnggcaacaaagggcccca
gatccaccacaccaaaagaagcggacttggtga

KEGG   Ursus arctos horribilis: 113255677
Entry
113255677         CDS       T05909                                 

Gene name
FGF2
Definition
(RefSeq) LOW QUALITY PROTEIN: fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04810  Regulation of actin cytoskeleton
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113255677 (FGF2)
   04015 Rap1 signaling pathway
    113255677 (FGF2)
   04010 MAPK signaling pathway
    113255677 (FGF2)
   04151 PI3K-Akt signaling pathway
    113255677 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113255677 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113255677 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255677 (FGF2)
   05205 Proteoglycans in cancer
    113255677 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    113255677 (FGF2)
   05218 Melanoma
    113255677 (FGF2)
   05224 Breast cancer
    113255677 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    113255677 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113255677 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255677 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113255677 (FGF2)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113255677 (FGF2)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113255677 (FGF2)
SSDB
Motif
Pfam: FGF IL1 Fascin
Other DBs
NCBI-GeneID: 113255677
NCBI-ProteinID: XP_026355134
UniProt: A0A3Q7WLU7
LinkDB
Position
Unknown
AA seq 378 aa
MWLGWRRVGLGRLLGNLAGVEPLELRRPLRSPPRSPSAPPPPPAAFGLPPGPMSRACVLR
PKLPTRRPAPKSPERVGGGAQEGRRAGGVGEWWWVFGGGDVEDVTPRPGRCQTSGRGARG
CCRIPGAAAGQAASXERPPRRHPALNPSSRAPRRTAHXGSRRAERPSGSRLGARGRGRAL
PGGRLGGRGRGRAPDRVGGRGRGAAAPRAAPGARAPRQSPGGAMAAGSITTLPALPEDGG
SGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV
CANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGP
KTGPGQKAILFLPMSAKS
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgtggctcgggtggcgcagggttgggctggggcgacttctggggaacttagccggggtc
gagcccctagagctgcggaggcctctgcggtcgcctccccgctcgccctccgcacctccc
ccgcccccggctgcgttcgggctccccccgggaccgatgtcgcgcgcttgcgtgctgcgg
ccaaagctcccgacccggaggccggccccaaaaagccccgagcgagtagggggcggcgcg
caggaagggaggagggccgggggcgtgggggagtggtggtgggtgttcgggggtggagat
gtagaagatgtgacgccgcggcccggccggtgccagaccagcggacgcggtgcccgcggt
tgctgccggatcccgggcgctgcagctgggcaggcggcctcctgagagcggccgccgcgg
agacacccagccctaaaccccagctcccgagccccgcggcgcaccgcgcactagggcagc
cggagagcggagaggccgagcggctcgaggctgggggcccgcgggcgcggtcgcgcgctg
ccgggcgggaggctggggggccggggccgtggccgtgccccggaccgggtcgggggccgg
ggccggggggcggcggctccccgcgcggctccaggggcgcgggcaccccggcagagcccc
ggtggggccatggcagccgggagcatcaccacgctgcccgccctgccggaggatggcggc
agcggcgccttcccgcccggccacttcaaggaccccaaacggctgtactgcaaaaacggg
ggcttcttcctgcgcatccaccccgacggccgagtggacggggtccgggagaagagcgac
cctcatatcaaactgcaacttcaagcggaagagagaggggttgtgtccatcaaaggagta
tgtgcaaatcgctatcttgccatgaaggaagatggaagattactggcttctaaatgtgtt
accgatgagtgtttcttttttgagcgactggaatctaataactacaatacttaccggtca
aggaaatactccagttggtatgtggcactgaaacggactgggcagtataaacttggaccc
aaaacaggacctgggcagaaagctatactttttcttccaatgtctgctaagagctga

KEGG   Ursus arctos horribilis: 113255787
Entry
113255787         CDS       T05909                                 

Gene name
PDGFC
Definition
(RefSeq) platelet-derived growth factor C isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04810  Regulation of actin cytoskeleton
uah05215  Prostate cancer
uah05218  Melanoma
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113255787 (PDGFC)
   04015 Rap1 signaling pathway
    113255787 (PDGFC)
   04010 MAPK signaling pathway
    113255787 (PDGFC)
   04072 Phospholipase D signaling pathway
    113255787 (PDGFC)
   04151 PI3K-Akt signaling pathway
    113255787 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113255787 (PDGFC)
   04540 Gap junction
    113255787 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113255787 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    113255787 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    113255787 (PDGFC)
   05215 Prostate cancer
    113255787 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113255787 (PDGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255787 (PDGFC)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113255787 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 113255787
NCBI-ProteinID: XP_026355327
UniProt: A0A3Q7W257
LinkDB
Position
Unknown
AA seq 345 aa
MLLFGLLLLTSALAGQRHGTQAESNLSSKFQYSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNMVLVWRLVAAEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVVPQFTEAVSPSVLPPSA
LPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKSGVRGLHKSLTDVALEHHEECDCVCRGHTGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcttcgggcttctcctgctgacatctgccctggccggccagagacacgggact
caggctgagtccaacctgagtagtaaattccagtactccagcaacaaggaacagaacgga
gtacaagatccccagcatgagagaattattactgtgtctactaatggaagtattcacagc
ccaagatttcctcatacttacccaagaaatatggtcttggtatggagactggtagcagca
gaggaaaatgtatggatacaacttacatttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgatttcgtagaagttgaagaacccagtgatggaacgatatta
gggcgttggtgtggttctggtactgtgccaggaaaacagatttctaaaggaaatcaaatc
aggataagatttgtatctgatgaatattttccttctgaaccagggttctgcatccactac
aacattgtcgtgccacaattcacagaggccgtgagcccttccgtgttacccccttcagct
ttgccactggatctgcttaataatgctgtcactgcgtttagtaccttggaagatctcatt
cggtatcttgaaccagacagatggcagttggacttggaagatctatataggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtggtggacctgaacctt
ctaaaggaggaggtaagactgtacagctgcacgccccgtaacttctcggtgtccataagg
gaagagctaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggtggaaactgtgcttgctgtctccacaactgcaatgagtgtcagtgtgtcccgagcaaa
gtcactaaaaaatatcatgaggtccttcagttgagaccaaagagtggggtccggggattg
cataaatctctcacagacgtggccctggagcaccacgaggagtgtgactgtgtgtgcaga
gggcacacgggaggataa

KEGG   Ursus arctos horribilis: 113256079
Entry
113256079         CDS       T05909                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04114  Oocyte meiosis
uah04115  p53 signaling pathway
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04510  Focal adhesion
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04730  Long-term depression
uah04750  Inflammatory mediator regulation of TRP channels
uah04913  Ovarian steroidogenesis
uah04914  Progesterone-mediated oocyte maturation
uah04935  Growth hormone synthesis, secretion and action
uah04960  Aldosterone-regulated sodium reabsorption
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05205  Proteoglycans in cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05410  Hypertrophic cardiomyopathy (HCM)
uah05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113256079 (IGF1)
   04015 Rap1 signaling pathway
    113256079 (IGF1)
   04010 MAPK signaling pathway
    113256079 (IGF1)
   04066 HIF-1 signaling pathway
    113256079 (IGF1)
   04068 FoxO signaling pathway
    113256079 (IGF1)
   04151 PI3K-Akt signaling pathway
    113256079 (IGF1)
   04152 AMPK signaling pathway
    113256079 (IGF1)
   04150 mTOR signaling pathway
    113256079 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113256079 (IGF1)
   04115 p53 signaling pathway
    113256079 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113256079 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    113256079 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    113256079 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    113256079 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    113256079 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113256079 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    113256079 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113256079 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    113256079 (IGF1)
   04213 Longevity regulating pathway - multiple species
    113256079 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256079 (IGF1)
   05202 Transcriptional misregulation in cancer
    113256079 (IGF1)
   05205 Proteoglycans in cancer
    113256079 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    113256079 (IGF1)
   05218 Melanoma
    113256079 (IGF1)
   05215 Prostate cancer
    113256079 (IGF1)
   05224 Breast cancer
    113256079 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    113256079 (IGF1)
   05414 Dilated cardiomyopathy (DCM)
    113256079 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113256079 (IGF1)
   01522 Endocrine resistance
    113256079 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113256079 (IGF1)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113256079 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 113256079
NCBI-ProteinID: XP_026355578
UniProt: A0A3Q7W2U5
LinkDB
Position
Unknown
AA seq 187 aa
MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKYRPPSTAKKTKSQRRRKGGPKKRPGGEQKVGTETSQQMKGKKKEQR
RETGARN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaactcaattatttaagtgctgcttttgtgatttcttg
aaggtaaagatgcacatcatgtcctcctcgcatctcttctacctggccctgtgcttgctc
accttcaccagctctgccacagctggaccggagacgctctgtggggctgaattggtggac
gctcttcagttcgtgtgtggagacaggggtttttatttcaacaagcccacggggtatggc
tccagcagtcggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctgaggaggctagagatgtactgcgcacccctcaagcctgccaagtctgcccgctca
gtccgtgcccagcgccacactgacatgcccaaggctcagaagtatcgtcccccatctacc
gccaagaaaacgaagtctcagaggagaaggaaaggtgggccaaagaaacgcccaggaggg
gaacagaaggtggggacggaaacaagtcagcagatgaaaggaaagaagaaagagcagaga
agggagactggagctagaaactga

KEGG   Ursus arctos horribilis: 113256194
Entry
113256194         CDS       T05909                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04640  Hematopoietic cell lineage
uah04916  Melanogenesis
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113256194 (KITLG)
   04015 Rap1 signaling pathway
    113256194 (KITLG)
   04010 MAPK signaling pathway
    113256194 (KITLG)
   04072 Phospholipase D signaling pathway
    113256194 (KITLG)
   04151 PI3K-Akt signaling pathway
    113256194 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113256194 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    113256194 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256194 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113256194 (KITLG)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113256194 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 113256194
NCBI-ProteinID: XP_026355716
UniProt: A0A3Q7V349
LinkDB
Position
Unknown
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICRNRVTDDVKDVTKLVANLPKDYKIALKYVPG
MDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSPKSPELRHFTPEEFFRIFNRSIDALKDLETVASKSSECVVSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNPIGDSSLQWAAMALPAFFSLVIGFAFGALYWKK
KQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactactcctatttaat
cctctggtcaaaactaaagggatctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagatagccctcaaatatgtccccggg
atggatgttttgcctagtcattgttggataagcgtgatggtggaacagttgtcagtcagc
ttaactgatcttctggacaaattttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtggatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcacctaaaagcccagaactcaggcattttacccctgaagaattc
ttcagaatttttaatagatccattgatgccctcaaggacttggagacggtggcatctaaa
agtagtgaatgtgtggtctcttcaacattaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaaccccattggagactccagcttacaatgggcagccatggca
ttgccagcattcttctctcttgtaattgggtttgcttttggagccttatactggaagaag
aaacaaccaaatctcacaaggacagttgaaaatatacagattaatgaagaggataatgaa
ataagtatgttgcaagaaaaagagagagagtttcaagaggtgtaa

KEGG   Ursus arctos horribilis: 113257435
Entry
113257435         CDS       T05909                                 

Gene name
FGF6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113257435 (FGF6)
   04015 Rap1 signaling pathway
    113257435 (FGF6)
   04010 MAPK signaling pathway
    113257435 (FGF6)
   04151 PI3K-Akt signaling pathway
    113257435 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113257435 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113257435 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    113257435 (FGF6)
   05218 Melanoma
    113257435 (FGF6)
   05224 Breast cancer
    113257435 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113257435 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113257435 (FGF6)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113257435 (FGF6)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113257435 (FGF6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113257435
NCBI-ProteinID: XP_026357384
UniProt: A0A3Q7WT70
LinkDB
Position
Unknown
AA seq 208 aa
MALGQRLFITMSPGAGRLQGTLQALVFLGVLVGMVVPSPAGTRANSTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtccccgggagcaggacgtcttcagggc
acgctgcaggctctcgtcttcctaggcgtcctagtgggcatggtggtgccctcgcctgca
ggcacccgggccaacagcacgctgctggactccaggggctggggcaccctgctatcaagg
tctcgagccggactagctggagagattgctggggtgaattgggagagtggctatttggtg
gggatcaagcggcagaggaggctctactgcaacgtgggcatcggctttcacctccaggtg
ccccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggagatt
tccacagtggagcggggtgtggtgagtctctttggagtgaaaagtgccctcttcgttgcc
atgaacagtaaagggagattatatgcaacgcccagcttccaagaggaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctatgagtcagacctgtaccgagggacctac
atcgcactgagcaaatacggacgggtaaagcgaggcagcaaggtgtccccaatcatgact
gtcactcacttccttcccaggatataa

KEGG   Ursus arctos horribilis: 113257991
Entry
113257991         CDS       T05909                                 

Gene name
NTF3
Definition
(RefSeq) neurotrophin-3 isoform X1
  KO
K04356  neurotrophin 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113257991 (NTF3)
   04010 MAPK signaling pathway
    113257991 (NTF3)
   04151 PI3K-Akt signaling pathway
    113257991 (NTF3)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113257991 (NTF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113257991 (NTF3)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113257991 (NTF3)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 113257991
NCBI-ProteinID: XP_026358416
UniProt: A0A3Q7VBB7
LinkDB
Position
Unknown
AA seq 348 aa
MFTGLRVEGSSPYRAAPRAAPRESPAQLLSSFFFLSFFFSFFPLLGSGGGGVGETLNDRA
RVHLSLHVDVPGNSHTDAMVTSATILQVNKVMSILFYVIFLAYLRGIQGNNMDQRSLPED
SLNSLIIKLIQADILKNKLSKQMVDVKENYQSTVPKAEAPRKPEQGEPAKSEFQPVIAMD
MDLLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGNPVVANRTSRRKRYAEHKSHRGEY
SVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGID
DKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgttcacgggactcagagttgaaggctcctctccctaccgagcagctccgcgcgcggcc
ccgcgagagagcccggcgcaactactttcttcctttttctttctttctttcttcttctct
ttttttcccctgctgggtagtggcggcggcggggtgggggagactttgaatgaccgagct
cgcgtccacctttctcttcatgtcgacgtccctggaaacagtcacacggatgccatggtt
acttctgccacgatcttacaggtgaacaaggtgatgtccatcttgttttatgtgatattt
ctcgcgtatctccgtggcatccaaggtaacaacatggatcaaaggagtttgcctgaagac
tcgctcaattccctgattattaagctgatccaggcagatattttgaaaaacaagctctcc
aagcagatggtggacgttaaggagaactaccagagcaccgtgcccaaagcggaggccccc
cgcaagccggagcagggagagcccgccaagtcggaattccagcccgtgattgcgatggac
atggacctgctgcggcaacagagacgctacaactcgccacgggtcctgctgagtgacagc
acccccctggagccccctcccttgtatctcatggaggattacgtgggcaaccccgtggtg
gccaacagaacgtcgcggaggaagaggtacgcggagcacaagagtcaccgaggggagtac
tccgtatgcgacagcgagagtctgtgggtaaccgacaagtcatcggccatcgacattcgg
ggacaccaggtcacggtgctgggggagatcaaaaccggcaactctcccgtcaaacaatat
ttttatgagacaagatgtaaagaagccaggcctgtcaaaaacggttgcagggggattgac
gataaacactggaactctcagtgcaaaacgtcccaaacctacgtccgagcactgacgtca
gaaaacaataaacttgtgggctggcgatggatacggatagacacctcctgtgtgtgtgcc
ttgtcgagaaaaatcggaagaacataa

KEGG   Ursus arctos horribilis: 113258001
Entry
113258001         CDS       T05909                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah04928  Parathyroid hormone synthesis, secretion and action
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113258001 (FGF23)
   04015 Rap1 signaling pathway
    113258001 (FGF23)
   04010 MAPK signaling pathway
    113258001 (FGF23)
   04151 PI3K-Akt signaling pathway
    113258001 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113258001 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    113258001 (FGF23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113258001 (FGF23)
  09162 Cancer: specific types
   05226 Gastric cancer
    113258001 (FGF23)
   05218 Melanoma
    113258001 (FGF23)
   05224 Breast cancer
    113258001 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113258001 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113258001 (FGF23)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113258001 (FGF23)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113258001 (FGF23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113258001
NCBI-ProteinID: XP_026358431
UniProt: A0A3Q7VBD2
LinkDB
Position
Unknown
AA seq 312 aa
MWTVEFFLFDVTRLPFKSPRGKRRESSLGSSGQIPTKKRRKRPARHSQGVREAVSGFKLQ
PAIQSAAMSGTRLGLLVSVLCWVVRAYPNTSPLLGSSWGGLTHLYTASARNSYHLQIHKD
GHVDGTPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDLRGNIFGSHLFSPESCRFRQR
TLENGYDVYHSPQHRFLVSLGQAKRTFLPGTNPPPYSQFLSRRNEIPLIHFNTPRPRRHT
RSAEDTERDPLNVLKPRPRMTPAPASCSQELPSAEDNSVVASDPLGVLRGNRVNAHAGGM
GVDRCRPFPKFI
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtggacagtggagtttttcctgtttgatgtcacacggctaccctttaaaagtccaagg
ggaaaaaggagggaatccagcctaggatcctcaggccagatacccacaaagaagagaaga
aagaggcctgcgaggcacagccagggagtcagggaggcagtgtcaggtttcaaactccag
ccagccattcagagcgctgcgatgtccgggacccgccttgggctcctggtctctgtcctg
tgctgggtagtcagagcgtatcccaacacctccccgctgctcggctccagctggggtggc
ctgacccacctgtacacagccagcgccaggaacagctaccacctgcagatccacaaggac
ggccatgtggatggcacaccccatcagaccatctacagtgccctgatgatcaggtcagag
gatgccggctttgtggtgataacaggtgtgatgagtaggcgatacctctgtatggacctc
agaggcaacatctttggatcccacctcttcagcccggagagctgcaggttccgacagcgg
acgctggaaaacggctacgacgtgtaccactccccgcagcaccgcttcctcgtcagcctg
ggccaggccaagaggaccttcctgccagggaccaacccgccgccctactcccagttcctg
tcccggaggaacgagatccccctcatccacttcaacacccccaggccaaggcggcacacg
cgcagcgccgaggacacggagcgcgacccactgaacgtgctgaagcccaggccccgcatg
acccccgccccggcctcctgctcccaggagctccctagcgccgaggacaacagtgtggtg
gccagcgacccgttaggggtactcagaggcaaccgggtgaacgcgcacgccggggggatg
ggcgtggacaggtgccgccccttccccaagttcatctag

KEGG   Ursus arctos horribilis: 113258433
Entry
113258433         CDS       T05909                                 

Gene name
ANGPT4
Definition
(RefSeq) angiopoietin-4 isoform X1
  KO
K05467  angiopoietin 4
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04066  HIF-1 signaling pathway
uah04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113258433 (ANGPT4)
   04015 Rap1 signaling pathway
    113258433 (ANGPT4)
   04010 MAPK signaling pathway
    113258433 (ANGPT4)
   04066 HIF-1 signaling pathway
    113258433 (ANGPT4)
   04151 PI3K-Akt signaling pathway
    113258433 (ANGPT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113258433 (ANGPT4)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113258433 (ANGPT4)
SSDB
Motif
Pfam: Fibrinogen_C HalX
Other DBs
NCBI-GeneID: 113258433
NCBI-ProteinID: XP_026358980
UniProt: A0A3Q7W1W3
LinkDB
Position
Unknown
AA seq 520 aa
MLSRPAMLLGGLLLAVAAVTVAQRRGQEAGGRRRAHRVQHGQCSYTFVLPEPEPCPPEPE
AFGGSNSLQRDSPAAALNLGDWPAQRVRQLEKVLENNTEQLQKLERYIQMNLRSELAQVQ
QHMVQNQTATMLELGTSLLNQTTAQTRKLTDVEAQGEQHVQRPSSGTVRASSRNIQEVLN
QTSRMEIQLLETSLSTNKLEKQLLLQGHELHRLQGRNSALETRVQALETQQQAELASLRG
EKERLRRLLGRQSGALAGLERSLRAASSNSSLLQRQQRELLESVQRLVRVVAQEPASVRA
AEQVFQDCAEIQRFGANVSGIYTIHVANMTEPRKVFCDMEANGGGWTLIQRRENGSVNFQ
RNWRDYKQGFGDLAGEHWLGNEVVHQLTSRAAYSLRVELQDWEGNEAYAQYEHFQLGSEG
QLYRLSLSGYSGSAGRQSSLVLQGTNFSTRDADNDNCLCKCAQMLSGGWWFDACGLSNLN
GIYYPARHHARKLNGIRWHYFQGPSYSLRATRMMVRPVGI
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgctctcccggccggccatgctgctggggggcctcctcctcgccgtggccgccgtgacc
gtggctcaaaggagggggcaggaggcgggcgggcgccgccgggcacaccgcgtccagcac
ggccagtgcagctacaccttcgtgctgcccgagcccgagccctgcccgccggagccggag
gctttcgggggctccaacagcctccagagggactcgccggcggccgcgctgaacctaggg
gactggccggcccagcgagtgcgacagctggagaaggtgctggagaacaacacagagcag
ctacagaagctagaaaggtacatccagatgaacttgaggtcagagctggcacaggtccaa
cagcacatggtccagaaccagacagccaccatgctggagctaggcaccagcctcctgaac
cagaccaccgcccagacccgcaagctgactgacgtggaggctcagggagaacagcatgtg
caaaggcccagcagcggaaccgtgcgggcaagctccaggaacatccaggaggtcctgaac
cagacatcccgcatggagatccagctgctggagacttcgctgtccaccaacaagctggag
aagcagctgctactgcagggccatgagctccacaggctgcagggccgcaacagcgcgctg
gagacgcgggtgcaggccctggagacgcagcagcaggcggagctggcttccctccgaggc
gagaaggagcggctgcggcgtctgctgggccgtcagagcggcgccctcgcgggcctcgag
cgcagcctgcgcgctgccagcagcaactccagtctcctgcagcgccagcagcgtgagctg
ctggagtctgtgcagcgcctggtgcgcgtcgtggcccaggagccggcctctgtgagggca
gctgagcaggtgttccaggactgtgcagagatccagcgcttcggggccaatgtcagtggc
atctacaccatccatgtggccaatatgacggagcccaggaaggtgttctgtgacatggag
gccaatggaggcgggtggactcttatccagcgccgggagaatggcagtgtgaacttccag
aggaactggagagattacaaacagggcttcggtgacctggccggggagcactggttgggc
aacgaggtcgtgcaccagctcaccagcagggctgcctactctctgcgcgtggagctgcaa
gactgggagggcaacgaggcctacgcccagtatgagcatttccagctgggcagcgagggg
cagctgtacaggctttctctgagtgggtacagcggttcagcagggcgccagagcagcctg
gtcctgcaaggcaccaacttcagcacccgtgacgcagacaatgacaactgtctctgcaag
tgtgcccagatgctgtccggaggatggtggtttgatgcctgcggcctctccaacctcaac
ggcatctactacccagctcgccaccacgcgcgcaagctcaacggcatccgctggcactac
ttccagggccccagctactcgctgcgggccacgcgcatgatggtgcgccccgtgggcatc
tga

KEGG   Ursus arctos horribilis: 113259246
Entry
113259246         CDS       T05909                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah05144  Malaria
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05211  Renal cell carcinoma
uah05218  Melanoma
uah05223  Non-small cell lung cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113259246 (HGF)
   04015 Rap1 signaling pathway
    113259246 (HGF)
   04010 MAPK signaling pathway
    113259246 (HGF)
   04151 PI3K-Akt signaling pathway
    113259246 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113259246 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113259246 (HGF)
   05205 Proteoglycans in cancer
    113259246 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113259246 (HGF)
   05226 Gastric cancer
    113259246 (HGF)
   05218 Melanoma
    113259246 (HGF)
   05211 Renal cell carcinoma
    113259246 (HGF)
   05223 Non-small cell lung cancer
    113259246 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    113259246 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113259246 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113259246 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113259246 (HGF)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113259246 (HGF)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113259246 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316 CWC25
Other DBs
NCBI-GeneID: 113259246
NCBI-ProteinID: XP_026360392
UniProt: A0A3Q7XCY5
LinkDB
Position
Unknown
AA seq 730 aa
MWGTKLLPVLLLQHVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMTSGVKKDFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTNVPM
ETTECIHGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWEKNME
DLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRN
KDLKDYEAWLGIHDVHGKGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTID
LPNYGCTIPEKTTCSVYGWGYTGSINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEIC
AGAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK
IILTYKIPQS
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtgggggaccaaacttctgccagtcctgctgctgcagcatgtcctcctacatctgctt
ctgcttcccatcgccatcccctatgcagaaggacagaagaaaagaagaaacacacttcat
gaattcaaaaagtcagcaaagactactctaattaaagaagacccattactgaagataaaa
acaaaaaaaatgaacactgcagaccaatgtgccaatagatgtattaggaataaaggactt
ccattcacttgcaaggcctttgtttttgataaagcaaggaaaagatgcctctggttccct
ttcaatagcatgacaagtggcgtgaaaaaagactttggtcatgaattcgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggaggtagctacaagggaacggta
tctatcactaagagtggcatcaaatgccagccctggaattccatgatcccacatgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccttggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttccgaagttgaatgcatgacctgcaatggggaaagttatcga
ggtcccatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgccagaaagatatcccgacaagggctttgatgataattattgc
cgcaatcctgatggcaaaccgaggccatggtgctatactcttgaccctgacaccccctgg
gagtactgtgcaattaaaatgtgcgctcacagtactatgaatgacacaaatgtccctatg
gaaacaactgaatgcattcatggtcaaggagaaggttaccggggcaccatcaatactatt
tggaatggaattccatgtcagcgttgggattcccagtatcctcaccagcatgacataact
cctgaaaatttcaagtgcaaggacctaagagaaaattattgccgaaatccagatggggct
gagtcaccctggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaaatgtgatgtgtcaagtggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaatttatccaaaactcgatctggactaacatgttcaatgtgggagaagaacatggaa
gacttacacaggcatatcttctgggaaccagatgctagtaagctgaataagaattactgc
cggaatcctgatgatgatgcccatggtccctggtgttacacaggaaatcctctcattcca
tgggattattgtcctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcctgtaatatcttgtgccaaaacgaaacaattaagagttgtaaatggaattcca
acgcgaactaatgtaggatggatggttagtttgaaatacagaaataaacatatctgtgga
ggatcattgataaaggaaagttggattcttaccgcaagacaatgtttcccttctcgaaac
aaagacttgaaagattatgaagcttggcttgggattcatgatgtccacggaaaaggagac
gagaaacgcaaacaagttctaaatgtttcccagctggtatatggacctgaaggatcagat
ctggtattactgaagcttgctaggcccgctgtcctggatgattttgttagtacaattgat
ttacctaattatggatgcaccattcctgaaaaaaccacttgcagtgtttatggctggggt
tatactggatccatcaactctgatggtctattacgagtagcacatctctatattatggga
aatgagaaatgcagccaataccatcaagggaaggtgactctgaatgagtctgaaatatgt
gctggagctgaaaatattgtatcaggaccatgtgagggggattatggtggcccacttgtt
tgtgaacaacataaaatgagaatggttcttggtgtcattgttcctggtcgtggatgtgcc
ataccaaatcgtcctggcatttttgtccgagtagcatattacgcaaaatggatacacaaa
attatattaacgtataagataccacagtcatag

KEGG   Ursus arctos horribilis: 113260127
Entry
113260127         CDS       T05909                                 

Gene name
PDGFD
Definition
(RefSeq) platelet-derived growth factor D isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04810  Regulation of actin cytoskeleton
uah05215  Prostate cancer
uah05218  Melanoma
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113260127 (PDGFD)
   04015 Rap1 signaling pathway
    113260127 (PDGFD)
   04010 MAPK signaling pathway
    113260127 (PDGFD)
   04072 Phospholipase D signaling pathway
    113260127 (PDGFD)
   04151 PI3K-Akt signaling pathway
    113260127 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113260127 (PDGFD)
   04540 Gap junction
    113260127 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113260127 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    113260127 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    113260127 (PDGFD)
   05215 Prostate cancer
    113260127 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113260127 (PDGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260127 (PDGFD)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113260127 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 113260127
NCBI-ProteinID: XP_026361664
UniProt: A0A3Q7X535
LinkDB
Position
Unknown
AA seq 370 aa
MRALGLVYTLVCANFCSYRDTSAAPQSAAIKALRNANLRRDESNHLTDLYRRDETIQVTG
SGHVQSPRFPNSYPRNLLLTWRLRSRENTRIQLAFDHRFGLEEAENDICRYDFVEVEDVS
ETSTIIRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPAAASE
TNWESVTSSVSGVSYHSPSVTDPTLTADALDKTVAEFDTVEDLLKHFNPESWQEDLENLY
LETPHYRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTHVVFFPRCLLVQ
RCGGNCGCGTINWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGRAKHMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcgcgcgctcggcctcgtctacacgctcgtctgcgccaacttttgcagctatcgggac
acttctgctgcgccgcagagcgcagccatcaaagctttgcgcaacgccaacctcaggcga
gatgagagcaatcacctcacagacttgtaccgaagagacgagaccatccaggtgacaggc
agcggccacgtgcagagccctcgcttccccaacagctaccccaggaatctgctcctcaca
tggcggctccgttcccgggagaacacaaggatacagctcgccttcgaccatcggttcggg
ctggaggaagccgagaatgacatctgtaggtatgattttgtggaagttgaagatgtatct
gaaaccagtaccataattagaggtcggtggtgtggacacaaggaagttcctccaaggatc
acatcaagaacgaaccaaattaaaataacattcaagtctgatgactactttgtggctaaa
cctggattcaagatttattattcttttgtggaagatttccaacccgcagcagcctcagag
accaactgggagtcagtcacaagctctgtctcaggggtatcctatcactctccatcagta
acggaccccaccctcactgcggatgctctggacaaaacagtcgcagaatttgataccgtg
gaagatctgctcaagcacttcaatccagaatcatggcaagaagatcttgagaatctatat
ttggagaccccccattatcgaggcaggtcctaccatgaccggaagtcaaaagtcgacctg
gacaggctcaatgatgacgtcaagcgctacagttgcactcccaggaattactccgtcaac
ttaagagaggagctgaagctcacgcacgtggtcttctttccccgttgcctcctcgtgcag
cgctgtgggggcaactgtggctgtgggaccatcaactggaaatcctgcacctgcagctcc
gggaaaactgtgaaaaagtatcatgaggtattaaagtttgagcctggccatttcaagagg
aggggcagagcgaagcacatggctctcgttgacatccagttggaccaccacgagcggtgt
gattgcatctgcagctcgagaccgcctcgataa

KEGG   Ursus arctos horribilis: 113260960
Entry
113260960         CDS       T05909                                 

Gene name
FGF10
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113260960 (FGF10)
   04015 Rap1 signaling pathway
    113260960 (FGF10)
   04010 MAPK signaling pathway
    113260960 (FGF10)
   04151 PI3K-Akt signaling pathway
    113260960 (FGF10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113260960 (FGF10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260960 (FGF10)
  09162 Cancer: specific types
   05226 Gastric cancer
    113260960 (FGF10)
   05218 Melanoma
    113260960 (FGF10)
   05224 Breast cancer
    113260960 (FGF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260960 (FGF10)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113260960 (FGF10)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113260960 (FGF10)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113260960 (FGF10)
SSDB
Motif
Pfam: FGF Fascin SR-25
Other DBs
NCBI-GeneID: 113260960
NCBI-ProteinID: XP_026362715
UniProt: A0A3Q7WCY0
LinkDB
Position
Unknown
AA seq 214 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSIPVTCQALGQDMVSPEATNSSSSSSSSSS
SSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEIT
SVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGR
QMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 645 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgcctggctgctgc
tgctgcttcttgttgctgttcttggtgtcttccatccctgtcacctgccaagcccttggt
caggacatggtgtcaccagaggccaccaactcctcttcttcctcctcctcctcgtcctct
tcctccttctcctctccttccagtgcggggaggcatgtgcggagctacaatcacctccaa
ggagatgtccgctggagaaagctattctcttttaccaagtactttctcaagattgagaag
aacgggaaggtcagcggtaccaagaaggagaactgcccgtacagtatcctagagataact
tcagtggaaatcggagttgttgccgtcaaagccattaacagcaactattatttagccatg
aacaagaaggggaaactctatggctcaaaagaatttaacaatgactgtaagctgaaggag
aggatagaggaaaatggatataacacatatgcatcctttaactggcagcacaatgggagg
caaatgtacgtggcattgaatggaaaaggagctcccaggagaggacagaaaacacgaagg
aaaaacacctcagcgcattttcttccaatggtggtacactcgtag

KEGG   Ursus arctos horribilis: 113261040
Entry
113261040         CDS       T05909                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04066  HIF-1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04370  VEGF signaling pathway
uah04510  Focal adhesion
uah04926  Relaxin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05219  Bladder cancer
uah05323  Rheumatoid arthritis
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113261040 (VEGFA)
   04015 Rap1 signaling pathway
    113261040 (VEGFA)
   04010 MAPK signaling pathway
    113261040 (VEGFA)
   04370 VEGF signaling pathway
    113261040 (VEGFA)
   04066 HIF-1 signaling pathway
    113261040 (VEGFA)
   04151 PI3K-Akt signaling pathway
    113261040 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113261040 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    113261040 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261040 (VEGFA)
   05206 MicroRNAs in cancer
    113261040 (VEGFA)
   05205 Proteoglycans in cancer
    113261040 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    113261040 (VEGFA)
   05211 Renal cell carcinoma
    113261040 (VEGFA)
   05219 Bladder cancer
    113261040 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113261040 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113261040 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113261040 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113261040 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113261040 (VEGFA)
   05165 Human papillomavirus infection
    113261040 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113261040 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261040 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113261040 (VEGFA)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113261040 (VEGFA)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113261040 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 113261040
NCBI-ProteinID: XP_026362750
UniProt: A0A3Q7WD18
LinkDB
Position
Unknown
AA seq 471 aa
MKSPDGHVVHVDTSRLPCPQELQREVEEERERTGSESARGRASNDRDRGKVSDLLLGVTA
RARREPSPLGSRSGPAALTDRQTDTAPRPSAHLLPGRRPRVDAAASRGQEPEPAPAGGVE
GVGARGVAVKLFVQLLGCSRSGGAVVRAGAAEPSGTGRSASSGREEPQSEEGEEEEEKEE
ERGPRWRLGARKPGSWTGEAAVCADSAPAARAPQALARASAPEGRGDSLGAEESGPPRSP
SRRGSASRAGSGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGEHKPHEVVKFM
DVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEGLECVPTEEFNITM
QIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQEKKSIRGKGKGQKRKRKKSRYKPWS
VPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgaagtctccagacgggcacgttgtccacgtggatacgtcacgcctcccgtgcccgcaa
gagctccagagagaagtcgaggaagagagagagaggacggggtcagagagcgcgcgcggg
cgagcgagcaacgacagggacaggggcaaagtgagtgacctgcttttgggggtgaccgcc
agagcgcggcgtgagccctcccccttgggatcccgcagcggaccagcagcgctgacggac
agacagacagacaccgccccccgccccagcgcccacctcctccccggccggcggccgagg
gtggacgcggcggcgagccgcgggcaagagccggagcccgcgcctgcaggcggggtggag
ggggtcggggctcgcggcgttgcagtgaaacttttcgtccaacttctgggttgttcccgc
tccggaggagccgtggtccgtgccggggcagccgagccgagcggaaccgggagaagtgct
agctcgggccgggaggagccgcagtcggaggagggggaggaggaagaagagaaggaagag
gagagggggccgcggtggcgactcggcgctcggaagccgggctcatggacgggtgaggct
gctgtgtgcgcagacagtgctccagccgcgcgcgcgccccaggccctggcccgggcctcg
gctccagaaggaagaggagacagcctaggcgccgaagagagcgggccgccccgcagtccg
agccggagagggagcgcgagccgcgccggctccggccgggcctccgaaaccatgaacttt
ctgctctcttgggtgcattggagccttgccttgctgctctacctccaccatgccaagtgg
tcccaggctgcacccatggcagaaggagagcacaaaccccacgaagtggtgaagttcatg
gacgtctaccagcgcagctactgccgtcccatcgagaccctggtggacatcttccaggag
taccccgacgagatcgagtacatcttcaagccgtcctgcgtgcccctgatgcggtgtgcg
ggctgttgtaatgacgagggcctggagtgcgtgcccaccgaggagttcaacatcaccatg
cagattatgcggatcaaacctcatcaaggccagcacataggggagatgagcttcctacag
cacagcaaatgtgaatgcagaccaaagaaagatagagcaaggcaagaaaaaaaatcaatt
cgaggaaagggaaaggggcaaaaaagaaagcgcaagaaatcccggtataaaccctggagc
gttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacc
tgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaac
gaacgtacttgcagatgtgacaagcccaggcggtga

KEGG   Ursus arctos horribilis: 113262031
Entry
113262031         CDS       T05909                                 

Gene name
FGF20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113262031 (FGF20)
   04015 Rap1 signaling pathway
    113262031 (FGF20)
   04010 MAPK signaling pathway
    113262031 (FGF20)
   04151 PI3K-Akt signaling pathway
    113262031 (FGF20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113262031 (FGF20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113262031 (FGF20)
  09162 Cancer: specific types
   05226 Gastric cancer
    113262031 (FGF20)
   05218 Melanoma
    113262031 (FGF20)
   05224 Breast cancer
    113262031 (FGF20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113262031 (FGF20)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113262031 (FGF20)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113262031 (FGF20)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113262031 (FGF20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113262031
NCBI-ProteinID: XP_026364063
UniProt: A0A3Q7WQW1
LinkDB
Position
Unknown
AA seq 211 aa
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAVERGARGGPGAAELAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDILMYS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttagccgaagtcgggggcttcctcggcggcctggagggcttgggccagcag
gtgggctcgcacttcctgctgcctcctgccggagagcggccgcctctgctgggcgagcgc
aggggcgcggtagagcggggcgcccgcggcgggcctggggctgcggagctggcgcacttg
cacggcatcctgcgccgccggcagctctactgccgcacgggcttccacctgcagatcttg
ccggacggcagcgtgcagggcacccggcaggaccacagcctcttcggtatcctggaattc
atcagtgtggcagtgggactggtcagtattagaggtgtggacagtggtctttaccttgga
atgaatgacaaaggagaactctatggctcagagaaattgacttctgaatgcatctttagg
gagcaatttgaagagaactggtataatacctattcatccaacatatataaacatggggac
actggccgtaggtattttgtggcacttaacaaagacggaactccaagagatggtgccagg
tccaaaagacatcagaaattcacacatttcctgcctagaccagtggatccagagagagtt
cccgaattgtacaaggacatcctgatgtacagctga

KEGG   Ursus arctos horribilis: 113262190
Entry
113262190         CDS       T05909                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin-2 isoform X1
  KO
K05466  angiopoietin 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04066  HIF-1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113262190 (ANGPT2)
   04015 Rap1 signaling pathway
    113262190 (ANGPT2)
   04010 MAPK signaling pathway
    113262190 (ANGPT2)
   04066 HIF-1 signaling pathway
    113262190 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    113262190 (ANGPT2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    113262190 (ANGPT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113262190 (ANGPT2)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113262190 (ANGPT2)
SSDB
Motif
Pfam: Fibrinogen_C Peptidase_C8 Spc29
Other DBs
NCBI-GeneID: 113262190
NCBI-ProteinID: XP_026364282
UniProt: A0A3Q7XNA9
LinkDB
Position
Unknown
AA seq 495 aa
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGRRQYQVQHGACSYTFLLPETDNCRSSSSYV
PNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKREMVELQQNAVQNQT
AVMIEIGTNLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEI
NKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNN
SVLQKQQHDLMETVHNLLTMISTSNSAKNSLDVKEEKVIFRDCAEVFKSGLTTNGIYTLT
FPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQKTWKEYKLGFGNPSGEHWLGNEFVF
QVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGN
DFTTKDVDNDKCICKCSQMLSGGWWFDACGPSNLNGMYYPQKQNTNKFNGIKWYYWKGSG
YSLKATTMMIRPADF
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgtggcagattgttttctttactttgagctgtgatcttgtcctagccgcagcctataac
aactttcggaaaagcatggacagcatcgggagaaggcagtatcaggttcagcacggagcc
tgcagctacactttcctcctgccggagacagacaactgtcgctcttctagctcctacgtg
cccaatgccgtgcagagggacgcaccactagattacgatgactcggtgcagaggctgcaa
gtgctggagaacatcatggaaaacaacactcagtggctaatgaagctcgagaattacatc
caggacaacatgaagagagaaatggtagagctgcaacagaatgcagtacagaaccagacc
gcggtgatgatagagatagggacaaacctgctcaatcaaacagcagcgcagacacggaag
ttgacagacgttgaagcacaagtattaaatcagacaacaagacttgaacttcagcttctg
gaacattccctttccaccaacaaattggaaaaacagattttggatcagaccagtgaaata
aacaaattgcaagataagaacagtttcctggaaaagaaagtactagacatggaagacaag
catatagttcaactacggtcaataaaagaagagaaagatcagctccaggtgttagtatcc
aagcaaaattccatcattgaagaactagaaaaacaactggtgaccgccacagtgaataat
tcagttctccaaaagcagcaacatgatctgatggagacagttcataatttattgaccatg
atatcaacgtcaaactcagcgaagaactccctcgatgttaaggaagagaaagtcattttc
agagactgtgcggaagtattcaagtcaggactgacaaccaatggtatctacacgctcaca
ttccctaattccacagaggagatcaaggcatactgcgacatggaaacctctggaggcggg
tggacggtcattcagcggcgtgaagatggcagtgttgattttcagaagacttggaaagaa
tacaaactgggatttgggaacccttccggcgaacactggctgggaaatgaatttgttttc
caagtgaccaatcaacagccctacgtgcttaaaatacaccttaaagactgggaggggaac
gaggcgtactcactgtatgaacatttctatctctccggtgaagaactcaattacaggatt
caccttaaaggacttacagggacggccggcaaaataagcagcataagccaaccaggaaat
gattttaccacaaaggatgtagacaacgacaaatgtatttgcaaatgttcacaaatgctc
tcaggaggctggtggtttgatgcgtgcggtccctccaacctgaacggaatgtactaccca
cagaagcagaacacaaacaagttcaacggtattaagtggtactactggaaaggctcaggc
tactcgctcaaggccacgaccatgatgatccgaccagcagatttctag

KEGG   Ursus arctos horribilis: 113262230
Entry
113262230         CDS       T05909                                 

Gene name
VEGFC
Definition
(RefSeq) vascular endothelial growth factor C
  KO
K05449  vascular endothelial growth factor C/D
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04668  TNF signaling pathway
uah04926  Relaxin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113262230 (VEGFC)
   04015 Rap1 signaling pathway
    113262230 (VEGFC)
   04010 MAPK signaling pathway
    113262230 (VEGFC)
   04668 TNF signaling pathway
    113262230 (VEGFC)
   04151 PI3K-Akt signaling pathway
    113262230 (VEGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113262230 (VEGFC)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    113262230 (VEGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113262230 (VEGFC)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113262230 (VEGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113262230 (VEGFC)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113262230 (VEGFC)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 113262230
NCBI-ProteinID: XP_026364336
UniProt: A0A3Q7VT66
LinkDB
Position
Unknown
AA seq 420 aa
MHLLGFFSLACSLLAAALLPGTRDAPAAAAAAFESGLGFSDSEPDADEAQAYADKDLEEQ
LRSASSVDELMTILYPEYWKMYKCQLRKGGWQRNKEQPNTNARTEETVKFAAAHYNAEIL
KSIDNEWRKTQCTPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTS
HLSKTLFEITVPLSQGPKPVTVSFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAA
NKTCPTNYIWNNHLCTCLAQQDFIFSSNSGDDSTDGFHDICGPNKELDEETCQCVCKGGL
RPSSCGPHKELDRNSCQCVCKNKLLPNSCGANREFDENTCQCVCKRTCPRNQPLNPGKCA
CECTENSQKCLLKGKKFQHQTCSCYRRPCTNRPKHCDQGLIFSEEVCRCVPSYWKRPHMN
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcacttgctgggcttcttctctctggcgtgttccctgctcgccgctgcgctgctcccg
ggtacgcgcgacgcgcccgctgccgccgccgccgccttcgaatcgggactcggcttctct
gactcggagcccgacgcggacgaggcccaggcgtatgcagacaaagatctggaggaacag
ttgcggtcagcgtccagtgtagatgagctcatgaccatactctacccagaatattggaaa
atgtacaaatgtcagttaaggaaaggcggttggcagcgtaataaagaacagcccaacacc
aatgcaagaacagaagagactgtaaaatttgctgcagcacattataatgcagagatcttg
aaaagtattgataatgagtggagaaaaactcagtgcacaccacgtgaggtgtgtatagat
gtggggaaggagtttggagcagcaacaaacaccttctttaaacctccatgtgtgtccgtc
tacagatgtggaggctgctgcaacagcgagggcctacagtgcatgaacaccagcacaagc
cacctcagcaagacgttgtttgaaattacagtgcctctctctcaaggccccaaaccagta
acagtcagttttgccaatcacacttcctgccgatgcatgtctaaactggacgtttacaga
caagttcattccattattagacgttccctgccagcaacactaccacagtgccaagctgcg
aacaagacttgccccacaaattacatctggaataatcacctctgcacatgtctggctcag
caagactttattttttcctcaaattctggagacgactctacagatggattccatgacatc
tgcggacccaacaaggagctcgatgaagaaacgtgtcagtgcgtctgcaaaggggggctc
aggccttccagctgtggaccccacaaagaactagacagaaactcatgccagtgtgtctgc
aaaaacaaacttttacccaactcatgtggggccaacagagaatttgatgaaaacacatgc
cagtgcgtatgtaaaagaacctgcccaaggaatcaacccctaaaccctggaaaatgtgcc
tgtgaatgtacagaaaattcacagaaatgcctcttaaaaggaaagaaatttcaacatcaa
acatgcagttgttacagaagaccatgtacaaatcgaccaaagcattgtgaccaaggactt
atattcagtgaagaagtatgtcgctgtgtcccttcatactggaaaagaccacatatgaac
taa

KEGG   Ursus arctos horribilis: 113263042
Entry
113263042         CDS       T05909                                 

Gene name
FGF5
Definition
(RefSeq) fibroblast growth factor 5
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113263042 (FGF5)
   04015 Rap1 signaling pathway
    113263042 (FGF5)
   04010 MAPK signaling pathway
    113263042 (FGF5)
   04151 PI3K-Akt signaling pathway
    113263042 (FGF5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113263042 (FGF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113263042 (FGF5)
  09162 Cancer: specific types
   05226 Gastric cancer
    113263042 (FGF5)
   05218 Melanoma
    113263042 (FGF5)
   05224 Breast cancer
    113263042 (FGF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113263042 (FGF5)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113263042 (FGF5)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113263042 (FGF5)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113263042 (FGF5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113263042
NCBI-ProteinID: XP_026365394
UniProt: A0A3Q7XG33
LinkDB
Position
Unknown
AA seq 270 aa
MSLSFLLLLFLSHLILSAWAHGEKHLAPKGQPGPAATGRNPGGASSSRSSSGTTSSSSSS
DSSSPGASLGSQGSGLEQTSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANML
SILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAI
HRTEPAGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQVEQPELSFTVTVPEKKK
PPSPVKPKVPVSAPRKSPNTVKYRLKFRFG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctcctcttcctcagccacctaatcctcagcgcctgggct
cacggggagaagcacctcgcccccaaagggcaacccggacccgctgccaccggtcggaac
ccgggaggcgccagcagcagccggagcagcagtggcacgacgtcttcctcttcttcctcc
gactcctcctcccccggggcttctctgggcagccaagggagcggcttggagcagaccagt
ttccagtggagcccctcggggcgccggaccggcagcctctactgcagagtgggcatcggt
ttccatctgcagatctacccggatggcaaagtcaatggctcccatgaagccaatatgtta
agtattttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagc
aacaaatttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacagat
gattgcaagttcagggagcgatttcaagaaaacagctataatacctatgcctcagcaata
cacagaactgagccagcgggccgggagtggtacgtggccctcaataagagagggaaggcc
aagcggggctgcagcccccgggtcaaaccccagcacatctccacccactttctgccaaga
ttcaagcaggtagagcagccagaactttctttcacagttactgttcctgagaagaaaaag
ccacccagtccagtcaagccaaaggttcccgtgtccgcccctcggaagagtcccaacacc
gtgaaatacagactcaagtttcgctttggataa

KEGG   Ursus arctos horribilis: 113263049
Entry
113263049         CDS       T05909                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04390  Hippo signaling pathway
uah05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113263049 (AREG)
   04012 ErbB signaling pathway
    113263049 (AREG)
   04390 Hippo signaling pathway
    113263049 (AREG)
   04151 PI3K-Akt signaling pathway
    113263049 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    113263049 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:uah03110]
    113263049 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113263049 (AREG)
Chaperones and folding catalysts [BR:uah03110]
 Intramolecular chaperones
  Others
   113263049 (AREG)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113263049 (AREG)
SSDB
Motif
Pfam: EGF FtsL Jak1_Phl
Other DBs
NCBI-GeneID: 113263049
NCBI-ProteinID: XP_026365397
UniProt: A0A3Q7XR24
LinkDB
Position
Unknown
AA seq 253 aa
MRAPLLPPAPVVLSLLILGSAHYAAGLDVNDTYSGKGEPFSGDHSADGLEVTPRSGMSSG
SEISPVSELPSSRELSSGIDYDYAEEYDNEPQISGYIVDGSVRVEQVIKPMKNKTESEKT
SDKPKRKKKGGKSGKNRRNRKKKNPCDAEFQNFCIHGECKYIEPLEAVTCICHQDYFGER
CGEKSMKTHSMVDNDLSKIALAAIAAFVSAVSFTAIAVVITIQLRKRYFREYEGEAEERK
KLRQENGNAHAIA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgagagccccgctgctgccgccggcgcccgtggtgctgtcgctcctgatcctaggctca
gcccattatgctgccggattggacgtcaatgacacctactctgggaaaggggaaccattt
tccggggaccacagcgctgatggattggaggttaccccaagaagtgggatgtcctcagga
agtgagatttcccctgtgagtgaactgccttctagtagggaactgtcctctgggatcgac
tatgactatgcggaagagtatgataacgaaccacaaatatctggctatatcgtggatggt
tcagtccgagttgaacaggtaattaagcccatgaaaaacaaaacagaaagtgaaaagact
tcagataaacccaaaagaaagaaaaaaggaggcaaaagtggaaaaaacagaagaaacaga
aagaagaaaaatccatgtgatgcagaattccaaaatttctgtattcacggagaatgcaaa
tatatagagcccctggaagctgtaacatgcatatgtcatcaggattactttggtgaacgg
tgtggggaaaagtccatgaagactcacagcatggttgacaatgatttatcaaaaatcgct
ttagcagccatcgctgcctttgtgtcagccgtgagcttcacggctattgctgttgttatc
acaatccagcttcgaaaacgatacttcagggaatatgaaggagaagctgaagaacgaaag
aaacttcgacaagaaaatggaaacgcacatgccatcgcgtaa

KEGG   Ursus arctos horribilis: 113263086
Entry
113263086         CDS       T05909                                 

Gene name
EREG
Definition
(RefSeq) proepiregulin
  KO
K09784  epiregulin
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04151  PI3K-Akt signaling pathway
uah05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113263086 (EREG)
   04012 ErbB signaling pathway
    113263086 (EREG)
   04151 PI3K-Akt signaling pathway
    113263086 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    113263086 (EREG)
SSDB
Motif
Pfam: EGF Sec66 DUF2207 OAD_gamma
Other DBs
NCBI-GeneID: 113263086
NCBI-ProteinID: XP_026365411
UniProt: A0A3Q7VWI0
LinkDB
Position
Unknown
AA seq 177 aa
MEEGLWLCGSLIKVSFPEGRVYIFGFLPSIGFHLLQAVLGTTVIPSCIPGESEDNCTALV
RIEDNPRVAQVSITKCGSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVQQ
PLSKEYVALTVILILLFLVIVAGSIYYFCRWYRNRKSKEPKKDYERVTSGDPALPQV
NT seq 534 nt   +upstreamnt  +downstreamnt
atggaggaaggactgtggttatgtggaagtctgatcaaggtttctttccctgaaggacgt
gtttatatatttggttttctcccatcaataggtttccatcttctccaagcagttctgggc
accactgtgattccttcctgcatcccgggagaatccgaagataactgcacggcgttagtt
cggatagaagacaatccacgtgtggctcaagtatccataacgaagtgtggctctgacatg
aacggctactgtttgcacggacagtgcatctacctggtggacatgagtcagaattactgc
aggtgtgaagtggggtacactggtgtccgatgcgagcacttctttttaaccgtccaacag
cccttgagcaaagaatacgtggctttgactgtgattctcattctcttgtttcttgtcata
gttgctggttccatatactacttctgcagatggtacagaaatcgaaaaagtaaagagccc
aagaaggactacgaaagggtgacgtcaggggacccagcattgcctcaagtctga

KEGG   Ursus arctos horribilis: 113264085
Entry
113264085         CDS       T05909                                 

Gene name
FGF18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113264085 (FGF18)
   04015 Rap1 signaling pathway
    113264085 (FGF18)
   04010 MAPK signaling pathway
    113264085 (FGF18)
   04151 PI3K-Akt signaling pathway
    113264085 (FGF18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113264085 (FGF18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113264085 (FGF18)
  09162 Cancer: specific types
   05226 Gastric cancer
    113264085 (FGF18)
   05218 Melanoma
    113264085 (FGF18)
   05224 Breast cancer
    113264085 (FGF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113264085 (FGF18)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113264085 (FGF18)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113264085 (FGF18)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113264085 (FGF18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 113264085
NCBI-ProteinID: XP_026366747
UniProt: A0A3Q7XUD3
LinkDB
Position
Unknown
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQAELQKPFKYTTVTKRSRRIRPTHPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacacttcctgctgctgtgcttc
caggtacaggtgctggcggccgaggagaacgtggacttccgcatccacgtggagaaccag
acgcgggctcgggacgatgtgagccgtaagcagctgcggctgtaccagctctacagccgg
accagcgggaagcacatccaggtgctgggccgcaggatcagcgcccgcggcgaggacggg
gacaagtatgcccagctcctagtggagacagacaccttcggtagtcaagtccggatcaag
ggcaaggagacggaattctacctgtgtatgaaccggaaaggcaagctcgtggggaagccc
gatggcaccagcaaggagtgtgtattcattgagaaggtcctggagaacaactacacagcc
ctaatgtccgccaagtactctggctggtacgtgggcttcaccaagaaggggcggccacgg
aagggtcccaagacgcgagagaaccagcaggacgtgcacttcatgaagcgctaccccaag
ggacaggcagagctgcagaagcccttcaagtacaccacggtgaccaagaggtcccggcgg
atccgccccacgcaccccggctag

KEGG   Ursus arctos horribilis: 113265088
Entry
113265088         CDS       T05909                                 

Gene name
BDNF
Definition
(RefSeq) brain-derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04024  cAMP signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04722  Neurotrophin signaling pathway
uah05016  Huntington disease
uah05030  Cocaine addiction
uah05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113265088 (BDNF)
   04010 MAPK signaling pathway
    113265088 (BDNF)
   04024 cAMP signaling pathway
    113265088 (BDNF)
   04151 PI3K-Akt signaling pathway
    113265088 (BDNF)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113265088 (BDNF)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    113265088 (BDNF)
  09165 Substance dependence
   05030 Cocaine addiction
    113265088 (BDNF)
   05034 Alcoholism
    113265088 (BDNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113265088 (BDNF)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113265088 (BDNF)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 113265088
NCBI-ProteinID: XP_026367988
UniProt: A0A3Q7X181
LinkDB
Position
Unknown
AA seq 247 aa
MTILFLTMVISYFGCMKAAPMKEANVRGQGSLAYPGVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPSEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaggaagcaaacgtccgaggacaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccaaggcaggttcgagaggcctgacttccttggct
gacacttttgaacacgtgatagaagagctgctggacgaggaccagaaagtccggcccagt
gaggagaacaataaggacgcggacttgtatacttccagggtgatgctcagtagtcaagtg
cctttggagcctcctcttctctttctgcttgaggaatacaaaaattacctggatgctgca
aacatgtctatgagggtccggcgccactctgaccccgcccgccgtggggagctgagcgtg
tgcgacagcattagcgagtgggtgacagcggcggataaaaagactgcagtggacatgtcg
ggcgggacggtcacggtccttgaaaaagtccctgtatcgaaaggccaactgaagcagtac
ttctatgagaccaagtgcaatcccatgggttacacaaaggagggctgcaggggcatagac
aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatg
gatagcaaaaagagaattggctggcgattcataaggatagacacttcctgtgtatgtaca
ctgaccattaaaaggggaagatag

KEGG   Ursus arctos horribilis: 113268295
Entry
113268295         CDS       T05909                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04915  Estrogen signaling pathway
uah05200  Pathways in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05223  Non-small cell lung cancer
uah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113268295 (TGFA)
   04010 MAPK signaling pathway
    113268295 (TGFA)
   04012 ErbB signaling pathway
    113268295 (TGFA)
   04151 PI3K-Akt signaling pathway
    113268295 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    113268295 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113268295 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113268295 (TGFA)
   05212 Pancreatic cancer
    113268295 (TGFA)
   05225 Hepatocellular carcinoma
    113268295 (TGFA)
   05214 Glioma
    113268295 (TGFA)
   05211 Renal cell carcinoma
    113268295 (TGFA)
   05215 Prostate cancer
    113268295 (TGFA)
   05223 Non-small cell lung cancer
    113268295 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113268295 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 113268295
NCBI-ProteinID: XP_026372466
UniProt: A0A3Q7WHF7
LinkDB
Position
Unknown
AA seq 157 aa
MRVCLVLEWLLESEGALQMTAKCLFSPPADPPVAAAVVSHFNDCPDSHSQFCFHGTCRFL
VQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIACVLIHC
CQVRKHCEWCQALICRHEKPSALLKGRTTCCHSETVV
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcgagtgtgtctggtcctggaatggctgttagaaagtgagggagcgctgcagatgaca
gccaaatgtcttttctctcccccagcagacccgcctgtggccgcagctgtggtgtcccat
tttaatgactgcccagattcccacagtcagttctgcttccatggaacctgcaggtttttg
gtgcaggaagacaagccagcgtgcgtctgccattctgggtacgtgggcgcgcgctgtgag
catgccgacctcctggccgtggtggctgccagccagaagaagcaggccatcaccgccttg
gtggtggtctccatcgtggccctggccgtcctcatcatcgcgtgtgtgctgatacactgc
tgccaggtccgaaaacactgtgagtggtgccaggctctcatctgccggcacgagaagccc
agtgccctgctgaagggaaggaccacttgctgccactcagaaacagtggtctga

KEGG   Ursus arctos horribilis: 113269603
Entry
113269603         CDS       T05909                                 

Gene name
FGF7
Definition
(RefSeq) fibroblast growth factor 7 isoform X1
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113269603 (FGF7)
   04015 Rap1 signaling pathway
    113269603 (FGF7)
   04010 MAPK signaling pathway
    113269603 (FGF7)
   04151 PI3K-Akt signaling pathway
    113269603 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113269603 (FGF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113269603 (FGF7)
  09162 Cancer: specific types
   05226 Gastric cancer
    113269603 (FGF7)
   05218 Melanoma
    113269603 (FGF7)
   05224 Breast cancer
    113269603 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113269603 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113269603 (FGF7)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113269603 (FGF7)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113269603 (FGF7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 113269603
NCBI-ProteinID: XP_026374234
UniProt: A0A3Q7Y1U9
LinkDB
Position
Unknown
AA seq 194 aa
MRKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGVPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacatggatcctgccaactttgctctacagatcatgctttcac
attatctgtctagtgggcactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccctgagcgacatacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactcttctgtcgaacacagtggtatctgaggattgat
aaacgaggcaaagtcaaaggaacccaagagatgaagaacagttacaatatcatggaaatc
aggacagtggcagttggaattgtggcaatcaaaggggtggaaagtgaatactatcttgca
atgaataaagaaggaaaactctatgcaaagaaagaatgcaatgaagattgcaacttcaaa
gaattaattctggaaaaccattacaacacatatgcatcagctaaatggacacacagcgga
ggagaaatgtttgttgctttaaaccaaaagggggttcctgtaagggggaaaaaaacgaag
aaagaacaaaaaacagcccactttcttcctatggcaataacataa

KEGG   Ursus arctos horribilis: 113270070
Entry
113270070         CDS       T05909                                 

Gene name
FGF17
Definition
(RefSeq) fibroblast growth factor 17 isoform X1
  KO
K04358  fibroblast growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05200  Pathways in cancer
uah05218  Melanoma
uah05224  Breast cancer
uah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113270070 (FGF17)
   04015 Rap1 signaling pathway
    113270070 (FGF17)
   04010 MAPK signaling pathway
    113270070 (FGF17)
   04151 PI3K-Akt signaling pathway
    113270070 (FGF17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113270070 (FGF17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113270070 (FGF17)
  09162 Cancer: specific types
   05226 Gastric cancer
    113270070 (FGF17)
   05218 Melanoma
    113270070 (FGF17)
   05224 Breast cancer
    113270070 (FGF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113270070 (FGF17)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113270070 (FGF17)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113270070 (FGF17)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113270070 (FGF17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 113270070
NCBI-ProteinID: XP_026374882
UniProt: A0A3Q7Y8B0
LinkDB
Position
Unknown
AA seq 216 aa
MGATRLLPSLALCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKKGKLVGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccacccgcctgctgcccagcctcgctctgtgtctgcaactactgattctctgc
tgtcaaacccagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggcgccatgaccgaccagctgagcaggcggcagatccgcgagtaccagctctacagccgg
accagcggcaagcacgtgcaggtcaccgggcgtcgcatctctgccactgcggaggacggc
aacaagtttgccaaactcatagtggagacggacacctttggaagccgtgtgcgcatcaag
ggtgctgagagtgagaaatacatctgtatgaacaagaagggcaagctcgttggaaagccc
agcgggaagagcaaagactgcgtgttcacggagatcgtgctggagaacaactacacggcc
ttccagaatgcccggcacgagggatggttcatggccttcaccaggcagggtcggccccgc
caggcttctcgaagccgccagaaccaacgagaggctcacttcatcaagcgcctctaccag
ggccagttgcccttccccaaccacgcagagaggcagaagcagttcgagttcgtgggctca
gcccccacccgccggaccaagcgcactcggaggccacagcccctgacgtag

KEGG   Ursus arctos horribilis: 113270324
Entry
113270324         CDS       T05909                                 

Gene name
PGF
Definition
(RefSeq) placenta growth factor isoform X1
  KO
K16859  placenta growth factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113270324 (PGF)
   04015 Rap1 signaling pathway
    113270324 (PGF)
   04010 MAPK signaling pathway
    113270324 (PGF)
   04151 PI3K-Akt signaling pathway
    113270324 (PGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113270324 (PGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113270324 (PGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113270324 (PGF)
Cytokines and growth factors [BR:uah04052]
 Growth factors
  Growth factors (RTK binding)
   113270324 (PGF)
SSDB
Motif
Pfam: PDGF Ribosomal_S26e
Other DBs
NCBI-GeneID: 113270324
NCBI-ProteinID: XP_026375276
UniProt: A0A3Q7Y8R3
LinkDB
Position
Unknown
AA seq 170 aa
MPAMRLFTCFLQLLAGLALPAVPPQQSALSAGNGSSEMEVVPFQEVWGRSYCRALERLVD
IVAEYPSEVQHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSQDRPSYVEL
TFSQHIRCECRPLWEKMKPERRRPKGRGKRKREKQRPTDCHLCGHTVPRR
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcctgccatgaggctgttcacttgcttcctgcagctcctggctgggctggcactgccc
gctgtgcccccccagcagtcggccttgtctgctgggaatggctcatcggagatggaagtg
gtgcccttccaggaagtgtggggccgcagctactgccgggccctggagaggctggtggac
atcgtggcggagtaccccagcgaggtgcagcacatgttcagcccgtcgtgcgtctccctg
ctgcgctgcacgggctgctgcggcgacgagaacctgcactgtgtgccggtggagaccgcc
aacgtaaccatgcagctcctgaagatccgctcccaggaccggccctcctacgtggagctg
acattctctcagcacatccgttgcgagtgcaggcctctgtgggagaagatgaagccagaa
aggaggagacccaagggcagggggaagaggaagagagagaagcagagacccacagactgc
cacctgtgcggccataccgttccccggaggtaa

DBGET integrated database retrieval system