KEGG   Ursus arctos horribilis: 113240790
Entry
113240790         CDS       T05909                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04630  JAK-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    113240790 (IL3RA)
   04151 PI3K-Akt signaling pathway
    113240790 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113240790 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113240790 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113240790 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113240790 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113240790 (IL3RA)
   04090 CD molecules [BR:uah04090]
    113240790 (IL3RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL3 receptor family
   113240790 (IL3RA)
CD molecules [BR:uah04090]
 Proteins
  113240790 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 113240790
NCBI-ProteinID: XP_026333992
UniProt: A0A3Q7V814
LinkDB
Position
Unknown
AA seq 377 aa
MALLWLAVCLTSSVSGLLQTEEDPDSPIKNLRMEPGEKRLTWDLHGNVSEIMCFINSKFI
TKAINNNRYCQFQVLSSCEVKNFTVSLTKGPPFLMGIQYPLQEGNPGASAQRLDCWVHDM
DFLTCSWEVGREAPSDVQYRLYRRHLWTRREQECPHYERDDRGKHVRCHFNDVPRLEKQL
QILVRGTSQGATIPCSDRTVELSEIEKLNPPNITGTCNKSYSMMEWKVSSHFNRRYEYEL
QIQKGSDPAYTEKLQENFFALYNPGNYMARLKVKGFFRNTWSEWSAPQHFVCDVGEDVQR
RDWLLSALGVLATLLVLGLAVVLCGRYSVLQKLFPPIPHMKDPTIDNLQSSKLVAWEASR
ASREDCPVAEVQVLGET
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggccttgctgtggctcgcggtgtgtctgacgtcgtctgtctcgggtctgctgcaaacg
gaggaagatcccgattccccgattaagaacctaaggatggagccgggagaaaagagattg
acttgggacctccatggaaatgtttctgaaattatgtgtttcataaattcaaaatttatc
actaaggccatcaacaacaaccgttactgccagttccaagtgctttcctcatgtgaagtg
aaaaacttcaccgtctccttgaccaaaggcccaccgttcttgatggggattcagtatcct
ctgcaagaaggaaaccctggggcatccgcacaacgtctggactgctgggtgcacgacatg
gacttcctgacgtgcagctgggaggtgggcagggaggcccccagtgacgtccagtatcgc
ctgtacaggcggcacctgtggacccgcagggagcaggagtgtccgcattatgaaagggac
gatcgggggaaacacgtccggtgtcatttcaatgacgtccccagattggagaaacagctc
cagatcctggtgagaggcacgagccaaggtgccacgatcccctgctcggaccgtactgtc
gaattatcagaaattgagaaattaaatccacccaatatcactggcacgtgtaataagtca
tattcgatgatggaatggaaagtgtcaagtcacttcaatcgcagatatgagtatgaactt
caaatacaaaagggcagcgatcccgcctacacagagaagctccaggaaaacttcttcgcg
ctttacaatcccggaaactacatggcgagactaaaggtgaaaggtttcttccgcaacacc
tggagcgaatggagtgccccccaacactttgtgtgcgacgtcggggaggacgtgcagcgc
cgggactggctgttgtctgcgctgggcgtgctggccacgctgctggtcctggggctggcg
gtcgtgctgtgcggaaggtactcggttttgcagaaactcttccctcccatccctcacatg
aaagaccccaccattgacaatcttcagagcagcaagttggtggcctgggaggccagcaga
gcaagccgggaggactgcccggtggcggaagtgcaggttttgggagaaacatga

DBGET integrated database retrieval system