KEGG   Ursus arctos horribilis: 113240790
Entry
113240790         CDS       T05909                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113240790 (IL3RA)
   04151 PI3K-Akt signaling pathway
    113240790 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113240790 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113240790 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113240790 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113240790 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113240790 (IL3RA)
   04090 CD molecules [BR:uah04090]
    113240790 (IL3RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL3 receptor family
   113240790 (IL3RA)
CD molecules [BR:uah04090]
 Proteins
  113240790 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 113240790
NCBI-ProteinID: XP_026333992
UniProt: A0A3Q7V814
LinkDB
Position
Unknown
AA seq 377 aa
MALLWLAVCLTSSVSGLLQTEEDPDSPIKNLRMEPGEKRLTWDLHGNVSEIMCFINSKFI
TKAINNNRYCQFQVLSSCEVKNFTVSLTKGPPFLMGIQYPLQEGNPGASAQRLDCWVHDM
DFLTCSWEVGREAPSDVQYRLYRRHLWTRREQECPHYERDDRGKHVRCHFNDVPRLEKQL
QILVRGTSQGATIPCSDRTVELSEIEKLNPPNITGTCNKSYSMMEWKVSSHFNRRYEYEL
QIQKGSDPAYTEKLQENFFALYNPGNYMARLKVKGFFRNTWSEWSAPQHFVCDVGEDVQR
RDWLLSALGVLATLLVLGLAVVLCGRYSVLQKLFPPIPHMKDPTIDNLQSSKLVAWEASR
ASREDCPVAEVQVLGET
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggccttgctgtggctcgcggtgtgtctgacgtcgtctgtctcgggtctgctgcaaacg
gaggaagatcccgattccccgattaagaacctaaggatggagccgggagaaaagagattg
acttgggacctccatggaaatgtttctgaaattatgtgtttcataaattcaaaatttatc
actaaggccatcaacaacaaccgttactgccagttccaagtgctttcctcatgtgaagtg
aaaaacttcaccgtctccttgaccaaaggcccaccgttcttgatggggattcagtatcct
ctgcaagaaggaaaccctggggcatccgcacaacgtctggactgctgggtgcacgacatg
gacttcctgacgtgcagctgggaggtgggcagggaggcccccagtgacgtccagtatcgc
ctgtacaggcggcacctgtggacccgcagggagcaggagtgtccgcattatgaaagggac
gatcgggggaaacacgtccggtgtcatttcaatgacgtccccagattggagaaacagctc
cagatcctggtgagaggcacgagccaaggtgccacgatcccctgctcggaccgtactgtc
gaattatcagaaattgagaaattaaatccacccaatatcactggcacgtgtaataagtca
tattcgatgatggaatggaaagtgtcaagtcacttcaatcgcagatatgagtatgaactt
caaatacaaaagggcagcgatcccgcctacacagagaagctccaggaaaacttcttcgcg
ctttacaatcccggaaactacatggcgagactaaaggtgaaaggtttcttccgcaacacc
tggagcgaatggagtgccccccaacactttgtgtgcgacgtcggggaggacgtgcagcgc
cgggactggctgttgtctgcgctgggcgtgctggccacgctgctggtcctggggctggcg
gtcgtgctgtgcggaaggtactcggttttgcagaaactcttccctcccatccctcacatg
aaagaccccaccattgacaatcttcagagcagcaagttggtggcctgggaggccagcaga
gcaagccgggaggactgcccggtggcggaagtgcaggttttgggagaaacatga

KEGG   Ursus arctos horribilis: 113240792
Entry
113240792         CDS       T05909                                 

Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113240792
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113240792
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113240792
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113240792
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113240792
   04090 CD molecules [BR:uah04090]
    113240792
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL3 receptor family
   113240792
CD molecules [BR:uah04090]
 Proteins
  113240792
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind fn3
Other DBs
NCBI-GeneID: 113240792
NCBI-ProteinID: XP_026333994
UniProt: A0A3Q7URB1
LinkDB
Position
Unknown
AA seq 413 aa
MQLWGWCMATVLDLVSFLVLLNSAWCGQAQLAQENISPIINMQLDSRKRMLTWNYIRNVS
RQECIIYTPPSSPSMPNFPTTQRPEVREDNTSFCIFRNRVLHRGANLTVKVTCDGVVSQK
VLPFANPGREGSGAVNFSCVIYNVRFMNCSWAPGPRAPADVRYQLFWWASLHEDEAECAH
YVVDPTGIRVGCHFDELGEPQRTDNYFFLVNGTSSETAIPFLDFVPFEAYKIEKYDPPAN
VTMSYNGSHRIIRWENPVIRYDLSSHVLYYELDIQTAGSSSKTKPVFQRGQDPNVYVMPR
SAVRPDTTIRVRVRYLYNDLWSEWSPTLRLGVPEQNFRGVLVGVVVAATAVPALVLMCLC
KRFSVRHKLLPRIPKVKKEITGTFTPPLEVTWEAGHLPPGSQEPEDVLMVEEM
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcagctttggggctggtgcatggcgaccgtgctggatcttgtgagcttcctggtcctc
ctgaactcagcgtggtgcggacaagcacagctggcacaagagaatatatctcctattata
aacatgcagctagattcaaggaaaagaatgttaacctggaattacataagaaatgtgagt
cggcaagaatgcataatatacaccccacccagctctcccagcatgcccaactttcccacc
acacaacgcccagaggtcagagaggacaacacatccttctgcatcttccgtaaccgcgtg
cttcatcggggggccaacctgaccgtgaaggtcacctgtgacggggtcgtgtcccagaaa
gtcctgccttttgcgaacccaggcagggaaggttccggcgccgtgaacttctcctgtgtc
atttacaacgtccgcttcatgaattgcagctgggcgcctggcccccgcgcccccgccgac
gtccgctatcagcttttctggtgggcctccttgcacgaggacgaggcggagtgcgcccac
tacgtcgtggaccccacggggatacgtgtgggctgccatttcgatgaactcggtgaaccc
cagcgtacggacaattacttcttcctggtgaacgggaccagcagtgagacagcaatccca
tttttggactttgttccatttgaagcctataaaatcgaaaagtatgaccctccagcaaac
gtcacgatgtcctacaacggatcgcatcgcattatccggtgggagaaccccgtgatcaga
tacgacctttcgagtcacgtcttgtattatgagctggacatccaaacagcggggagctcc
tccaagacaaagcccgttttccagaggggacaagatccgaatgtgtacgtgatgccccgt
tctgccgtcagacccgacaccacgatccgggtgagggtgcgttacctgtataacgacctc
tggagcgaatggagcccaacgctgcgtctcggcgtcccggagcagaacttccgcggcgtc
ctggtcggcgtggtggtggcagccacggctgtgcccgcgctggtcctcatgtgcctctgc
aaacggttctcggtcaggcacaagctattaccccgcatccccaaggtgaagaaggaaatc
acggggacctttacgccgcccctggaggtcacctgggaggcgggccacttgccgccgggc
tcccaggaacccgaggacgtcctcatggtggaggaaatgtga

KEGG   Ursus arctos horribilis: 113240793
Entry
113240793         CDS       T05909                                 

Gene name
CSF2RA
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform X1
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113240793 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113240793 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113240793 (CSF2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113240793 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113240793 (CSF2RA)
   04090 CD molecules [BR:uah04090]
    113240793 (CSF2RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL3 receptor family
   113240793 (CSF2RA)
CD molecules [BR:uah04090]
 Proteins
  113240793 (CSF2RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 113240793
NCBI-ProteinID: XP_026333996
UniProt: A0A3Q7TEA4
LinkDB
Position
Unknown
AA seq 441 aa
MLERRETEQESRWPGQSLVRWGFPRLSGSPMGLGATAVLFCMLLDPVFLQTLEQQDLPTV
AGIPSLNMKFDSWRMELSWDCKENTTYLKCVMIHKEKGPIEITPQEKDCHCKFSDYSLHD
GVTLMVKVNSTQRPIPETLVYTNTGGEGTAAQNFSCFIYNANFMNCSWAKGQTAPDDVQY
FLYIRDSSLEFYRKKRERECPRYIEDSGTHVGCHLEDLSGLASYNYFLVNGTSQGTGIQF
FDSVLSWKKIEIFSPPNNISVHCNRSHCLIRWEKPKTRHNLPNWEFKYQLDIQKQSNKEH
SENQLIEVSGNWENNYHFPSPEPRAKHTVKIRASDARIEKWGAWSQAVEFGSKEPKPSLV
PIYVLVVLGTLLTALILGCLLKRFFASERLFPPIPRIKDKWNDSHQRDHQVIWENFTSDT
EKGDNEEILTVEEVTVTPASV
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgttggagcgccgggaaaccgagcaagaaagcaggtggccagggcagagcctggtgcgg
tggggttttcctcgtctttcgggcagccctatgggactcggggccacagccgtcctgttt
tgcatgctcctggacccagttttcctccagactctggagcagcaggatcttccaaccgtg
gcagggatccccagtctaaatatgaagtttgactcttggagaatggaactgagttgggac
tgcaaagaaaacactacctacctcaagtgcgtgatgattcacaaggagaaagggccaatc
gaaataacaccccaggagaaagactgtcactgcaagttttcggattattctctccatgat
ggagtcacgctcatggtcaaagtaaatagcacccaaagaccgattccagaaacactggtc
tacactaacacaggtggggagggcacagctgcccaaaacttctcgtgttttatctacaat
gccaacttcatgaactgcagttgggcaaagggtcaaactgcccctgatgacgtccaatat
tttttgtacatacgcgactcaagtttggaattttataggaaaaaaagggaaagagagtgt
cctcgttacatagaagactcaggaacccacgtgggatgccacctggaagacctctcagga
ttagcgagctacaattacttcctggtgaacggtaccagccaagggacaggaatccagttc
tttgattcggttttgtcgtggaagaaaatcgaaatatttagcccacccaacaatatcagt
gtgcactgcaacaggtcccactgcctgattcggtgggaaaagcccaagacccgacataac
ctgcccaactgggagttcaaataccaactggacatccagaaacagagcaataaggaacac
agcgagaatcaactgattgaggtgtccggaaattgggaaaataactaccacttcccgagt
ccggagcccagagccaagcatactgtgaaaataagggcctcagacgcacgcattgagaaa
tggggtgcctggagccaggccgttgagtttggctccaaggaacccaagcccagcctcgtg
cccatctatgtgctggtggtcctggggaccctcctcaccgccctgatcctaggctgcctt
ttgaaaaggttcttcgcgtcagaaaggttattcccgccgattccacgcatcaaagacaaa
tggaatgatagccatcagcgtgaccaccaggtcatctgggagaacttcacgtcggacacg
gagaaaggtgacaacgaagagatcctcaccgtggaagaagtcacagtgactccagcaagc
gtgtga

KEGG   Ursus arctos horribilis: 113240794
Entry
113240794         CDS       T05909                                 

Gene name
CRLF2
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113240794 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113240794 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113240794 (CRLF2)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113240794 (CRLF2)
SSDB
Motif
Pfam: Tissue_fac
Other DBs
NCBI-GeneID: 113240794
NCBI-ProteinID: XP_026333998
UniProt: A0A3Q7UCV0
LinkDB
Position
Unknown
AA seq 388 aa
MSHDGTALLLTLSCVCATMWTACLPWAPAALFLLADVIVSEDSAPEAALHPQIINFNFEV
VQVTWNASKYPGTNLTFLYKLSSDETSSQCSNYILQQSHTAGCFLEAKKDEILCFSIRNG
THLLLTKCQWISAYLKPSSPKDLNFQWHQEAITVTCSDLPYKRLLYEIQYKSMFDTEWQS
KEGETCNITTDGLDAEKCYFFRARVKTMESSYGPDTYPSDWSEVTHQQRGQLRDSCQEKK
LFPKFILISGTVALLTVFLLLLSLWKVWRVKKLLMPTVPDPKFTFPGLFESHQGNFQEWI
KDTQNVAHVNKLEAAEQECIPEDALVVHLVKNEAETAIVTTSPLCPQTEEEEVSGDPSQL
PFRPMHGGEMVSLGGFTFVMSDNSYITL
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgagccatgacggcacggcccttctgctcaccctgtcgtgtgtctgtgccaccatgtgg
acggcgtgtctgccctgggcgcctgcagccctcttcctgctggccgacgtgatcgtttcc
gaggactcggcaccggaggcagcattgcaccctcagatcatcaactttaattttgaagtt
gtgcaggttacgtggaacgcaagcaaataccctgggacaaacttgactttcctctacaaa
ttaagcagtgatgagaccagtagccaatgctccaactatattcttcagcaaagtcacact
gctggatgcttcctggaggcaaaaaaggatgaaattctgtgcttttccatcagaaatgga
acacatctccttctcaccaagtgccagtggatcagcgcgtacttgaaacccagctccccg
aaagacttgaacttccagtggcatcaggaagccatcacggtgacctgctctgatctgccc
tacaagcgtctcctctatgaaatccagtacaagagtatgtttgacactgagtggcagtcc
aaggagggagaaacctgcaatattacgacagatggcttggatgctgagaaatgttatttc
tttcgggccagagtgaagacaatggagtccagctacggccctgacacatacccaagtgac
tggtcagaggtgacacaccagcagaggggacagctgagagattcgtgccaggagaaaaag
cttttcccgaagttcattttaatttctggcacggttgccttgctgaccgtgttccttctt
cttctgtctttatggaaagtatggagagttaagaagctcctcatgcccaccgtgcccgat
cccaaattcaccttccctgggctctttgaatcccaccagggtaacttccaggagtggatc
aaagacacgcagaacgtggcccacgtgaataagctggaggctgcggagcaggagtgcatc
ccggaagacgccctagttgtccacctggtcaagaacgaagccgagacggccatcgtgacg
accagccctttgtgcccacagacagaggaggaagaggtctccggggaccccagtcagctc
cctttccggcccatgcacggcggcgagatggtctctcttgggggttttacgtttgtgatg
agtgacaactcatacataacgttatga

KEGG   Ursus arctos horribilis: 113241139
Entry
113241139         CDS       T05909                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin-15 receptor subunit alpha isoform X1
  KO
K05074  interleukin 15 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04672  Intestinal immune network for IgA production
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113241139 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113241139 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    113241139 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113241139 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113241139 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113241139 (IL15RA)
   04090 CD molecules [BR:uah04090]
    113241139 (IL15RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113241139 (IL15RA)
CD molecules [BR:uah04090]
 Proteins
  113241139 (IL15RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 113241139
NCBI-ProteinID: XP_026334493
UniProt: A0A3Q7UE96
LinkDB
Position
Unknown
AA seq 288 aa
MGPPPSATGHKTKWTSGVPRGEERRGGEGPQASAGITCPPPTSVEHADIRVKSYKVSSRE
RYTCNSGFKRKAGTSSLTECVLNETTNVAHWTIPNLKCIRDPSLTHLRPSSTEVPAGVTP
EPESTSLSGKEPAFTSKSDTTVATKPAVVPGSRLMPSKPPATGTTGPIGKEPSRAPPQAT
AKASEHTPSASQETPGTYSYNSGTVTAAIFTPVAVLSVMCVVLLLVCYQKSRQTLQTPSV
EMEHMEVMPMTRGTDSREDDAENHPHDLGHSRGRLRAAEGGAKAPTLP
NT seq 867 nt   +upstreamnt  +downstreamnt
atggggccgcctccctctgcgacgggacacaagaccaagtggacttctggggtccccaga
ggcgaggagagaagaggaggggaaggaccccaggcctctgcaggcatcacatgccctcct
cccacgtcggtcgaacatgcagacatccgggtcaagagttacaaagtgagctccagggag
cggtacacgtgtaactctggcttcaagcgtaaagctgggacatccagtctgactgaatgc
gtgctcaatgagaccaccaacgttgcccactggacaattcccaatctcaagtgcatcaga
gacccctccctgactcacctaaggccatcctccacagaagtgccagcaggggtgacccca
gagccagagagcacctccctttctggaaaagagccagctttcacttccaagtcagacacc
acagtggccacaaagcccgctgttgtgccaggctccaggctgatgccatcaaagcctcct
gctacaggaaccacagggccgatcggtaaagaaccctcccgagccccacctcaggcaaca
gcaaaggcctcggaacacactccctctgcctcacaggagacgccaggtacatattcgtac
aattctggaaccgtgactgcggcgatcttcacacctgtcgctgtgctcagtgtcatgtgt
gtggtacttcttctggtctgttaccaaaaatcgaggcaaactttgcagacacccagtgtt
gaaatggaacacatggaagtgatgccaatgaccaggggaaccgacagcagagaggacgac
gcagaaaaccacccacatgacctcggacactccagggggagactgagggcagcagagggt
ggagcgaaggcgccaaccctgccctag

KEGG   Ursus arctos horribilis: 113241140
Entry
113241140         CDS       T05909                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha isoform X1
  KO
K05068  interleukin 2 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113241140 (IL2RA)
   04151 PI3K-Akt signaling pathway
    113241140 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113241140 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113241140 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113241140 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113241140 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    113241140 (IL2RA)
   04659 Th17 cell differentiation
    113241140 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113241140 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113241140 (IL2RA)
   05162 Measles
    113241140 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113241140 (IL2RA)
   04090 CD molecules [BR:uah04090]
    113241140 (IL2RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113241140 (IL2RA)
CD molecules [BR:uah04090]
 Proteins
  113241140 (IL2RA)
SSDB
Motif
Pfam: Sushi Ntox37
Other DBs
NCBI-GeneID: 113241140
NCBI-ProteinID: XP_026334496
UniProt: A0A3Q7TF97
LinkDB
Position
Unknown
AA seq 267 aa
MEPSLLMWGISTFVTVSAYVTDLCDGYPPDLKHATYRALEYKTGTVLNCGCERGYRRLSN
FMHCAGNASHASWENRCQCRSTSSKSTERQITPRPKEQKEMQSPTPPGDQGNLLGHCREP
PSWEHEDPKRIYHFAVGQTVHYQCAQGFRALHRGSAQSVCKRISGKTQWSQPQLKCISER
TDSPFPDDEEEPQASTRAPGRDTSSPLQMTSTTDFHKHTEVATSAESFIFTTEYQIAVAG
CVLLLISVLLLSGLTWQRRWRKSRRTI
NT seq 804 nt   +upstreamnt  +downstreamnt
atggagccaagcttgctgatgtggggaatctctacattcgtcacagtgtctgcctacgtg
acagacctgtgtgacggttacccgccagacctcaagcacgccacatacagagctctcgag
tacaagacgggcacggtgttaaattgtgggtgtgagagaggctaccgcagactaagcaac
ttcatgcattgtgcgggaaacgccagccacgcttcctgggaaaacagatgccagtgcaga
agtacatcctccaagagcacagaaagacaaattactcctagacccaaagaacagaaggaa
atgcagagcccaacgccgcccggggaccaagggaaccttctaggtcactgcagggagcct
ccttcctgggaacatgaagatccaaagagaatctaccacttcgcggtggggcagacggtt
cactaccagtgcgcgcagggattcagggccctacacagaggttctgcccagagcgtctgc
aaaaggatctcagggaagacccagtggtcacagccccagctcaagtgcataagtgagagg
acggacagtccgtttccagatgacgaagaagagcctcaagcaagcacccgtgctcctggg
agagacacttcctcccccttgcaaatgacaagtactaccgatttccacaaacacacggaa
gtggctacctccgcagagtcgttcatattcacaaccgagtatcagatagcagtggccggc
tgcgttctcctgctgatcagcgtcctccttctgagcgggctcacctggcagcggagatgg
aggaagagtagaagaaccatctag

KEGG   Ursus arctos horribilis: 113241251
Entry
113241251         CDS       T05909                                 

Gene name
IL13RA2
Definition
(RefSeq) interleukin-13 receptor subunit alpha-2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113241251 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113241251 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113241251 (IL13RA2)
   04090 CD molecules [BR:uah04090]
    113241251 (IL13RA2)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL3 receptor family
   113241251 (IL13RA2)
CD molecules [BR:uah04090]
 Proteins
  113241251 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind LIFR_N DUF3844
Other DBs
NCBI-GeneID: 113241251
NCBI-ProteinID: XP_026334642
UniProt: A0A3Q7V9X4
LinkDB
Position
Unknown
AA seq 386 aa
MAFIHLDVRCLYTLLICTAFGSVPSNAEIKVNPPEDFEIVDPGYLGYLSLQWQPPLFLDN
FKGCTIEYELKYRNIDSEHWKTIITKNLHYKDGFDLNKGVEAKIHTLLPAQCTNGSEVRS
SWSETAYWTSPEGNLETKIQDMDCVYYNWQYLLCSWKSGMGVHFDTNYQLFYWYEGLGRT
TQCADYIKINGKNMGCRFPYLESSDYKDFYICVNGSSESHPIRPSYFIFQLQNIVKPLPP
EYLSLTVKNSEEINLKWSIPKGPIPAKCFIYEIEFTEDDTTWVTTTIENEIQITRTSNES
QKLCFLVRSKVNMYCSDDGIWSEWSDEQCWKGDIWKETLIFFLIPFAFVSLFVLVITCLL
LYKQRALLKTIFQTKKEVFSHQETFF
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggctttcattcatttggatgtcagatgtctctataccctacttatttgcacagcattc
ggctctgtgccttcaaatgctgagataaaagttaatcctcctgaggattttgagatagtg
gatcctggatatttaggttatctgtctttgcaatggcaacctccactgtttctggataat
tttaagggatgtacaatagaatatgaattaaaataccgaaacattgatagtgaacactgg
aagaccatcattaccaagaatctacattacaaagacgggtttgatcttaacaagggtgtt
gaagcaaagatacacacacttctgccagcccaatgcacaaatggatcagaagttcgaagt
tcatggtcagaaactgcttattggacatcaccagaaggaaatctggaaactaaaattcag
gatatggactgtgtatattacaactggcaatatttactgtgctcttggaaatctggcatg
ggtgtccattttgataccaattaccaattgttttactggtatgagggcttgggtcgtaca
acacagtgtgctgattacatcaagattaatggaaaaaatatgggatgcaggtttccctat
ttggagtcatcagactataaagatttctacatctgtgttaatgggtcatcagaatcccat
cctataagacccagctattttatttttcagcttcaaaatatagttaaacctttgccacca
gagtatcttagtcttactgtgaagaattcagaggaaattaacctgaaatggagcattcct
aaaggacccattccagcaaaatgtttcatttatgaaattgaattcacagaagatgatact
acctgggtgactaccacaattgaaaatgagatacaaatcacaagaacatcaaatgaaagc
caaaaattatgctttttggtaagaagtaaagtgaatatgtattgctcagatgatggaatc
tggagtgagtggagtgatgaacaatgctggaaaggtgacatatggaaggaaaccttaata
tttttcctgataccatttgcttttgtctcattatttgttttggtaataacttgtctgctt
ttgtataagcaaagggctttactgaaaacgatctttcaaacaaaaaaagaagtcttttct
catcaagagacattcttttga

KEGG   Ursus arctos horribilis: 113241264
Entry
113241264         CDS       T05909                                 

Gene name
IL13RA1
Definition
(RefSeq) interleukin-13 receptor subunit alpha-1 isoform X1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113241264 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113241264 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113241264 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113241264 (IL13RA1)
   04090 CD molecules [BR:uah04090]
    113241264 (IL13RA1)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL3 receptor family
   113241264 (IL13RA1)
CD molecules [BR:uah04090]
 Proteins
  113241264 (IL13RA1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind LIFR_D2
Other DBs
NCBI-GeneID: 113241264
NCBI-ProteinID: XP_026334660
UniProt: A0A3Q7U307
LinkDB
Position
Unknown
AA seq 457 aa
MERPARLCGLWALLLCAGGGGGGGAAPTDTQPPVTNLSVSVENLCTVIWTWDPPEGASPN
CTLRYFSHFDNKQDKKIAPETHRSKEVPLNERICLQVGSQCSTNESDNPSILVEKCTPPP
EGDPESAVTELQCVWHNLSYMKCTWLPGRKTSPDTNYTLYYWHSSLGKILQCEDIYREGQ
HIGCSFALTNLKDSSFEQHSVQIVVKDNAGKIRPSFNIVPLTSHVKPDPPHIKRLFFQNG
NLYVQWTNPQNFYSRCLSYQVEVNNSQTETSDIFYVEEAKCQNSEFEGNLEGTICFMVPG
VLPDTLNTVRIRVRTNKLCYEDDKLWSNWSQAMSIGENTDPTFYVSMLLATPVIVACAII
VLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLQSSPVQLHTRQKNEPFPSRIMELE
NEHGPRGHPASCPPVAGRQGRIHCRGTVRDVKMERCV
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggagcggccggcgcggctctgcggactgtgggcgctgctgctctgcgccggcggcggc
ggaggcgggggcgccgcgcccaccgatactcagccacctgtgacgaatttgagtgtttct
gttgaaaacctctgcacggtcatatggacatgggatcctccagagggagccagcccgaat
tgcaccttacggtattttagtcattttgacaacaagcaggataagaaaattgctcctgaa
acccatcgttcaaaagaagtgcccctgaacgagaggatttgtctgcaagtggggtcccag
tgcagcaccaatgaaagtgacaatcctagcattttggtggagaagtgcaccccgcccccg
gaaggtgatcctgagtccgcggtgactgagctgcaatgcgtttggcacaacctgagctac
atgaagtgtacttggctccccggacggaagacaagtcctgacaccaactataccctctac
tattggcacagcagcctgggaaaaattcttcaatgtgaagacatctatagggaaggtcaa
cacattggctgttcctttgctctcactaatttaaaggattccagttttgaacagcacagt
gtccaaatagtggtcaaggataatgcaggaaaaattagaccatccttcaatatagtgcct
ttaacttctcatgtgaaacctgatcccccacatattaaacgtctcttcttccaaaatggt
aacttgtatgtgcaatggacgaatccacagaatttttacagcagatgcttatcttatcaa
gtggaagtcaataacagccaaactgagacgagtgatattttctacgttgaagaggccaaa
tgtcagaattcagaatttgagggaaacctggagggtacaatttgtttcatggtccccggt
gtgcttcctgatactttgaacacagtcagaataagagtcagaacaaataagttatgctat
gaggatgacaaactctggagtaattggagtcaagcgatgagtataggtgagaataccgac
cccacgttctacgtcagcatgttgcttgccactccggtcatcgtcgcttgcgccatcata
gtcctcctgctttatctcaaaaggctcaagatcattatattccctccgattcctgatcct
ggcaagatttttaaagaaatgtttggagaccagaatgatgataccctgcagtcctcccca
gtgcaactgcatacgcggcagaaaaacgagccttttccttctagaattatggaattagag
aatgaacatggccccagaggtcatccagcgagctgtcccccggttgcggggagacaaggt
cgaatccattgccgtggcaccgttcgtgacgtgaagatggagcgctgtgtgtag

KEGG   Ursus arctos horribilis: 113243022
Entry
113243022         CDS       T05909                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113243022 (EPOR)
   04151 PI3K-Akt signaling pathway
    113243022 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113243022 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113243022 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113243022 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113243022 (EPOR)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  Prolactin receptor family
   113243022 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 113243022
NCBI-ProteinID: XP_026337251
UniProt: A0A3Q7TLY9
LinkDB
Position
Unknown
AA seq 509 aa
MDHLWARLWPGVSSFCLLLAGAAWASPPRPLDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPDNYSFFYQLEGEPWKPCSLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAVSSGAPRYRRIIHINEVVLLDPPAGLLARRADEGGHVVLRWLPPPGAPVASLIR
YEVNISSGNVAGGAQKVEILDGRTECVLSNLRGGTRYTFMVRARMAEPSFGGFWSAWSEP
ASLLTASDLDPLILTLSLILVLILLLLAVLALLSHRRALKQKIWPGIPSPESEFEGLFTT
HKGNFQLWLYQNEGCLWWSPCTPFAEDPPAPLEVLSERCWGATQAVEPGAEDEGPLLEPV
GSERTQDTYLVLDKWLLPRSPPSEALPRPDGGLDTVAMDKGSEASSCSSALSLKPVPEGT
LGTSFEYTILDPSSQLLRPRALPPELPPTPPHIKYLYLMVSDSGISTDYSSGGSQGAQGD
SSNGPFSNPYENSLIPGAEPSPPNYVACS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggatcacctctgggcgcgcctctggcctggagtcagctctttctgtctcttgctcgct
ggggctgcctgggcttccccacccagacctctggaccccaagtttgaaagtaaagcggcc
ctgctggctgcccgcgggcccgaagagcttctgtgcttcaccgaacggttggaagacttg
gtgtgtttctgggaggaagcggccagcgccggggtcggccccgacaactacagtttcttc
taccagctcgagggcgagccatggaagccatgcagcctgcaccaggcgcccacggcccgc
ggcgctgtgcgtttctggtgctcgctgcctacggcagacacgtcgagcttcgtgccctta
gagctgcgcgtcacagcggtatcctcgggcgctccacgctatcgccgtatcatccacatc
aacgaagtggttctcctggacccccccgcggggctgctggcgcggcgggccgacgagggc
ggccacgtggtattgcgttggctcccgcctcctggggcccccgtggccagcctcatccgc
tacgaagtgaacatctcctctggcaacgtcgcggggggcgcacagaaggtggagatcctg
gatggtcgtactgagtgcgtgctgagcaacctccggggtggaacccgttacaccttcatg
gtacgcgcgcgtatggccgagccgagcttcggtggcttctggagcgcctggtctgagcct
gcgtcgctgctgacagctagtgacttggatcccctcatcctgacgctctccctcatcctt
gtgctcatcctgctgctgctggccgtgctcgccctgctctcccaccgccgggctctgaag
cagaagatctggcctggcatcccaagccctgagagtgagtttgagggcctcttcaccaca
cacaagggtaacttccagctgtggctgtaccagaatgagggctgtctttggtggagcccc
tgcactccctttgcagaggacccacccgcccccctggaagtcctctctgagcgctgctgg
ggggcaacacaggcggtggagccaggggcagaggatgagggacccctgctggagcccgtg
ggcagtgaacgtacccaggacacctacctggtgctggacaagtggctgctgccccggagc
ccacccagtgaggctctcccgcggcctgatggcggtttggacacagtggccatggataaa
ggctccgaagcatcctcctgctcatctgctttgtccctgaagcccgtgccagaggggacc
ttgggtaccagctttgagtataccatcctggatcccagctcccagctcttgcgcccaagg
gcactgccccctgagctgccccccaccccaccccacataaagtacctgtaccttatggtg
tctgactctggcatctcaactgactacagctcagggggctcccagggagcccagggggac
tcatccaatggccccttctcgaatccttatgagaacagcctcatcccaggcgctgagcct
tcacctcccaactacgtggcctgctcctag

KEGG   Ursus arctos horribilis: 113245310
Entry
113245310         CDS       T05909                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04066  HIF-1 signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04659  Th17 cell differentiation
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah05163  Human cytomegalovirus infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113245310 (IL6R)
   04066 HIF-1 signaling pathway
    113245310 (IL6R)
   04151 PI3K-Akt signaling pathway
    113245310 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113245310 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113245310 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113245310 (IL6R)
   04659 Th17 cell differentiation
    113245310 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113245310 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113245310 (IL6R)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113245310 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113245310 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113245310 (IL6R)
   04090 CD molecules [BR:uah04090]
    113245310 (IL6R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113245310 (IL6R)
CD molecules [BR:uah04090]
 Proteins
  113245310 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 Ig_2 ig fn3 I-set Ig_5
Other DBs
NCBI-GeneID: 113245310
NCBI-ProteinID: XP_026341088
UniProt: A0A3Q7UWQ0
LinkDB
Position
Unknown
AA seq 466 aa
MLALRCALLTALLAAPGAALAPGGCPAPEVVSDAVTSLPGASVTLLCPGGEPGDAVHWLL
GNRAAGPHQGSWAAVGRKLLLRSVQLSDSGNYSCYQDGRLLGTVRLLVDAPPEEPQLSCF
RKSPLSKVACEWSPRHPPSPTTRATLLVRKFRSVPLGDSQEPCPYAQGSRKFSCRLAVPE
GDNSLYVVSLCVSNSAGSRSSSPQTFEGYGILQPDPPANITVTAVDGNPRWLSVTWQDPP
SWNSYFYRLQFELRYRAERSKTFTTWMVQELRHRCIIYDAWRGMRHVVQLRAREEFGHGS
WSAWSQEATGTPWTESRSPPAESEVSPSTQALTTNEDDESSLSKSSANATSLPVQDSSPV
PLPTFLVAGGSLAFGTLLCVGIVLRFRRTWKLHALKEGKASVHPPYSLGQLVPERPKPTP
GLVPLISPPVSPSSLGSDSTSRPSRPDARGPQSPYDISNRDYFFPR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgctggccctgcgctgcgctctgctgacagccctgctggccgcgccgggggccgccctg
gccccagggggctgccccgcgccggaggtggtgagcgatgcagtgaccagcctgcctggg
gccagcgtgaccctgctctgcccgggcggggagccaggagacgccgttcactggctgctg
gggaatcgtgcagcgggcccgcaccagggcagctgggccgctgtgggaaggaagctgctt
ctgaggtccgtgcagctcagcgactctggaaactattcatgttaccaggacggccgcctg
ctcggaaccgtgcgtttgctggtggatgccccccctgaggagccccagctctcctgcttc
cggaagagtcccctcagcaaggtggcctgtgagtggagtcctcggcacccaccgtccccg
acgaccagggccacattactggtgaggaagtttcggagcgtcccgctgggagactcccag
gagccgtgcccgtatgcccaggggtcccggaagttctcctgccggctggcggtcccggag
ggcgacaactccttgtacgtcgtgtccctgtgcgtcagcaacagtgccggaagcaggtcc
agcagtccccagacgtttgagggctacggaatcctgcagcccgacccgcctgccaacatc
accgtcactgctgtggacggaaacccccgctggctcagtgtgacctggcaggaccccccc
tcctggaactcctatttctacaggctgcagtttgagctccgataccgggctgaacggtca
aagacgttcacaacgtggatggtccaggagctccggcaccgctgcatcatctacgacgcc
tggagaggcatgcggcacgtggtgcagcttcgggcgcgggaggagttcggccatggctcc
tggagcgcctggagccaggaggccacgggcaccccttggacagaatccaggagccctcca
gctgagagcgaggtgtccccctccacgcaggcgctgactactaatgaggacgatgaaagt
agtctctctaaaagttctgcaaatgcaaccagcctcccagtgcaagactcttctccagtg
ccactgcccaccttcctggtggccggaggaagcctggccttcgggacgctcctgtgtgtc
ggcatcgtcctgaggttcaggaggacgtggaagctgcatgcactgaaggaaggcaaggcg
agcgtgcacccgccatactcgctgggacagctggtgcccgagagacccaagcccaccccg
gggctggtgcccctcatctccccgccagtgtcccccagcagccttgggtctgacagcacc
tcgaggcccagccggccggatgccaggggcccacagagcccttacgacatcagcaacaga
gactacttcttccccagatag

KEGG   Ursus arctos horribilis: 113245352
Entry
113245352         CDS       T05909                                 

Definition
(RefSeq) interleukin-9 receptor-like
  KO
K05073  interleukin 9 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113245352
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113245352
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113245352
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113245352
   04090 CD molecules [BR:uah04090]
    113245352
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113245352
CD molecules [BR:uah04090]
 Proteins
  113245352
SSDB
Other DBs
NCBI-GeneID: 113245352
NCBI-ProteinID: XP_026341194
UniProt: A0A3Q7VE57
LinkDB
Position
Unknown
AA seq 504 aa
MGSSPHGEDPTGVLSAQSLAGWALEREALMRELSTWLLVCTCIVSRVGLGVSVQEEGGGP
GAGSFTCLSNNIVRIDCRWSAPELGRGPSPWLLFTSNDVPGSKHRCVFRASECTVVLPPE
EVLVPSDNFTVTFHRYVSGKEQVSLVDPHYLPRRHVKLDPPSGLQSNVSSDYCVLTWSVS
PALEPLTSVLSYELAFKKQEEAWEQARHRDHIVGVTRLTLEAVELDPGSHYEARLRVQMA
APEDDMMEELRYEGQWSEWSQSACFPAPQSPARGSLFSHWGQPDSSILVAVPVFLLLTSL
TYLMFKLSPRVKRSFSQNVPSPVAFFQSLYSVHNGDFQTWIGAHRTGLLPSQDCAGSPRG
ASESSVREAIEWLTYDPVDPCQSVVLEEEREGPGTGLPEAVLLGGHVVQGGQPPAYLPQE
DWVPASPNRPAPPRSDCSSGDYWALGCPGGWYPSTFPGNTRSSGPSPALACDLSWDQQSL
DAWQGSGPVGVGHSERQVPAAQIP
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggggagcagccctcacggggaggatcccacgggggtgctctcagcccagtcccttgca
gggtgggccttggagcgcgaggccctgatgcgagagctgagcacctggctgctggtctgc
acctgcatcgtcagtcgggtcggcttgggagtctccgtccaggaggaaggaggagggccc
ggggctggatctttcacctgcctcagtaacaacatcgtgaggattgactgccgctggtct
gccccagagctgggccgtggtcccagtccctggctcctctttaccagcaacgacgtgccg
ggcagcaagcacagatgtgtcttccgggccagtgagtgcactgtggtgctgccacccgag
gaggtgctcgtgccttccgacaacttcaccgtcactttccaccgttacgtctctgggaag
gagcaggtcagcctggtggacccacactacctgccccggagacatgtgaagttggaccct
ccctctggcttacagagcaatgtcagctctgactactgtgtcctgacctggagcgtcagt
cctgccttggagcccctgacctccgtcctcagctacgagctggccttcaagaagcaggaa
gaggcctgggagcaggcccggcacagggatcacatcgtcggggtgacccggctcaccctc
gaagctgtcgaactggaccccggttcccactatgaggcccggctgcgggtccagatggcc
gccccggaggatgacatgatggaggagctgcgctatgagggccagtggagcgaatggagc
cagtcagcctgcttccccgctccccagagccctgcccgaggctccctgttctcacattgg
gggcagcccgacagcagcatccttgtggctgtgcctgtctttctgctgctgaccagcctg
acctacctcatgttcaagctttcgcccagggtgaagagaagcttctcccagaacgtgccc
tctccagtggcgttcttccagtccctctacagtgtgcacaacggggacttccagacctgg
ataggggcccacagaactggtctgctgccgagccaggactgcgccggttccccacgagga
gcctcggagtctagtgtccgggaggccattgagtggctgacctatgacccagtggatccc
tgtcagtccgtggtcctggaggaagagcgggagggccctggcaccggcctcccagaagct
gtgctgctaggggggcatgtggtccagggagggcagccacctgcctacctgccacaggag
gactgggtccccgcgagccccaacaggccagctcccccacgctcagattgcagcagtggt
gactactgggccctgggctgccccggggggtggtacccctccaccttcccaggaaacaca
cggagctctgggcccagcccagctttggcctgtgacctttcttgggaccagcagagcctg
gatgcctggcaaggaagtgggcctgtgggagtcggtcacagtgagaggcaggtccctgct
gcacagatcccgtga

KEGG   Ursus arctos horribilis: 113245610
Entry
113245610         CDS       T05909                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma isoform X1
  KO
K05070  interleukin 2 receptor gamma
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113245610 (IL2RG)
   04151 PI3K-Akt signaling pathway
    113245610 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113245610 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113245610 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113245610 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113245610 (IL2RG)
   04659 Th17 cell differentiation
    113245610 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113245610 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113245610 (IL2RG)
   05340 Primary immunodeficiency
    113245610 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113245610 (IL2RG)
   05162 Measles
    113245610 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113245610 (IL2RG)
   04090 CD molecules [BR:uah04090]
    113245610 (IL2RG)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113245610 (IL2RG)
CD molecules [BR:uah04090]
 Proteins
  113245610 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 113245610
NCBI-ProteinID: XP_026341554
UniProt: A0A3Q7VF95
LinkDB
Position
Unknown
AA seq 383 aa
MLKPPLPLRSLLFLQLPLLGVGLNSTVPMPNGNEDVTAGGKRGTEGVDFFLTATPPGTLS
VSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPINLTLNYWYKNSKDDKVQECGHYLFSGET
TAGCWLQKEEIHLYETFVVQLQDPQEPRRQSIQMLKLQNLVIPWAPENLTLRNLSESQLE
LSWSNRHLDHCLEHLVQYRSDWDRSWTEQSVDHRNSFSLPSVDGQKFYTFRVRSRYNPLC
GSAQRWSEWSHPIHWGSNTSKENPLLFASEAVLIPLGSMGLIICLICVYYWLERVMPRIP
TLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPC
SQHSPYWAPPCYTLKPETGALIP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgttgaagccaccattgccactcagatccctcttattcctgcagctgcctctgctgggg
gtggggctgaactcgacggtccccatgcccaatgggaatgaagacgtcacagctggtggg
aaacgtgggactgaaggggttgatttcttcctgaccgctacaccccctgggaccctcagc
gtttctaccctgcccctcccagaggtccagtgttttgtgttcaatgttgagtacatgaat
tgcacttggaacagcagctctgagccccagcccatcaacctgactctgaactactggtac
aagaactccaaggatgataaagtccaggagtgtggccactatctattttctggagagacc
actgctggctgttggctgcaaaaggaggagatccatctctacgaaacatttgttgtccag
ctccaggacccacaggaacccaggaggcagtccatacagatgctaaaactgcagaatctg
gtgatcccctgggctccggagaacctaacccttcgcaacctgagcgaatcccagctagaa
ctgagctggagcaacagacacttggaccactgtttggagcacctcgtgcagtaccggagt
gactgggaccgcagctggactgaacaatccgtggaccaccgaaatagcttttctctgcct
agcgtggatgggcagaaattctacacgttccgtgtccggagccgctataacccactctgt
ggaagcgctcagcgttggagtgaatggagccaccccatccactggggcagcaatacttcc
aaggagaatcctttgttgtttgcatcggaagctgtgcttatcccccttggctccatggga
ttgattatttgccttatctgtgtgtactactggctggaacgggtgatgccccgaattcct
accctcaagaacctagaggatctggttactgaataccacgggaacttttcggcctggagt
ggagtgtctaagggactggcggagagtctgcagccagactacagtgaatggctctgccac
gtcagtgagattcccccaaaaggaggggctccaggggaggggcctgggggctccccctgc
agccagcatagcccctactgggctcccccatgttacaccctgaaacctgaaactggagcc
ctgataccctga

KEGG   Ursus arctos horribilis: 113247162
Entry
113247162         CDS       T05909                                 

Gene name
IL27RA
Definition
(RefSeq) interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113247162 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113247162 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113247162 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113247162 (IL27RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113247162 (IL27RA)
SSDB
Other DBs
NCBI-GeneID: 113247162
NCBI-ProteinID: XP_026343862
UniProt: A0A3Q7W0Y9
LinkDB
Position
Unknown
AA seq 654 aa
MRGARAAPFRPRPKLVLLPLLVLLCHRTRSQGSPGPLQCYGVGPLGDLNCSWEAVGDLGD
PSTLHLQSQKYHSNRTWTVPVPTGQSWVTIPREQLTMSDELLVWGTKAGQPLWPSVFVNL
ETRMKPGAPRLYPDVDFSEDEPLEATIHWAPPVWPPHKVLVCQFYYRRCQETTWTLLEPE
VRSRPLAPVEIQDLELATGYEVHGRCRMEKEKNLWSERSPVLSFQTLPSAPKDVWVSGNL
CGTPGRQEPLLLWKDRGRCMQMSYRVWFQAEDQELVQKTVPCCSSFVPTQAEWVGVSAVN
ATSWEPLTNLSLACLGLDFAPHGVAVSNVAGSTELLVTWQRGPGELQEHVVDWARDGDPL
EDLNWIRLPPENLSALLPGNFEGGVPYRITVTAVSSWGLAPAPSVWRFREELAPLAGPVL
WRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCVQSGTRPSVCMNVSGSTRNITLPDLHW
GPCELWVTASTIAGQGPPGPSLRLHLPDNTLKWKVLPGVFLLWGLLLTGCGVSLATSGRC
LHLRHKVLPRWVWEKIPDPANSSCGQPHMEEVPQAQPPGDFPILKVEEMEPLPVTEPPQA
STQLDSGYEKHFLPTPEELGLLGPPPGPKVWPEPTPDQERGAHVTDEDTEAQRG
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgcggggggcccgggccgcccccttccggccgcggccgaagctggtgctgctgcctctg
ctggtgctgctgtgccaccggactcggtcccagggcagccctgggccactgcagtgctat
ggagttggacccttgggcgacctgaactgctcgtgggaagctgtgggggacctgggagac
ccctccacgctgcacctccagagccagaagtaccattccaacagaacgtggactgtgcca
gtgcctaccgggcagagctgggtgaccatcccgcgggaacagcttaccatgtctgatgaa
ctgcttgtctggggtaccaaggcaggccagcctctctggccctcagtcttcgtgaacctg
gaaaccagaatgaagccaggtgccccccggctgtaccccgatgtcgacttctcagaggat
gagcccctggaggccactatccactgggccccgcctgtgtggccaccccataaggtcctg
gtctgccagttctactatcgaagatgccaggagacaacctggaccctgctggaaccggaa
gtgaggtccaggcccctggcccctgttgagatccaggacctggagctggccactggttat
gaggtacatggccgctgccgaatggagaaggaaaagaatctgtggagcgagcggagcccc
gttttgtccttccagacgctgccctctgctccaaaagacgtatgggtatccgggaacctc
tgcgggacaccaggcagacaggaacccctgcttctgtggaaggaccgggggcgctgcatg
cagatgagctaccgagtctggttccaggctgaagaccaggagctggtccaaaagacggtt
ccctgctgcagctccttcgtcccaacccaggccgagtgggtcggggtgtctgccgtcaat
gccacgagctgggagcctctcaccaacctttctctggcctgcttgggtctagatttcgcc
ccccacggcgtggcggtcagcaacgttgccgggagcacggagctgctggtgacttggcag
cgggggcctggggagttgcaggagcacgtggtggattgggctcgagacggggatcccctg
gaggacctcaactggatccggctcccccctgagaacctcagtgctctgttgccagggaat
tttgaaggaggggtcccgtaccgaatcacagtgacagcagtctcttcttggggtttggcc
cctgccccctcagtctggaggttcagagaggaactggcacccctagccgggccagtgctt
tggcgactccaggatgcgcccccagggacccccgccatagcgtggggagaggtcccaagg
caccaactccggggccatctcacccactacactttgtgtgtacagagcgggaccaggcct
tctgtctgcatgaacgtgagtggcagcacccggaacatcaccctgcccgaccttcactgg
ggtccttgtgagctgtgggtgaccgcatccaccatcgcaggacaggggccacctggtccc
agcctccggcttcacctaccagataacaccctgaagtggaaagttctgccgggtgtcttt
cttctgtggggcttgctcctgacgggctgtggcgtgagcctagccacctctggaaggtgc
ctccaccttcggcacaaggtactgccccgctgggtctgggagaagattccggatccggcc
aatagcagttgtggccagccccacatggaggaggtgcctcaggctcagccccccggcgac
ttccccatcctgaaagtggaggagatggagccactaccggttacggagcccccccaggcc
tccacccagctggactctggctatgagaaacacttcctgcccacccctgaggagctaggc
cttctgggcccgcccccaggtcccaaggtctggcctgagcccacccctgaccaggagagg
ggtgcccacgtgacagatgaagacactgaggctcagagaggctga

KEGG   Ursus arctos horribilis: 113249383
Entry
113249383         CDS       T05909                                 

Definition
(RefSeq) interleukin-2 receptor subunit beta-like isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113249383
   04151 PI3K-Akt signaling pathway
    113249383
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113249383
   04061 Viral protein interaction with cytokine and cytokine receptor
    113249383
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113249383
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113249383
   04659 Th17 cell differentiation
    113249383
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113249383
   05202 Transcriptional misregulation in cancer
    113249383
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113249383
   05162 Measles
    113249383
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113249383
   04090 CD molecules [BR:uah04090]
    113249383
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113249383
CD molecules [BR:uah04090]
 Proteins
  113249383
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 113249383
NCBI-ProteinID: XP_026346683
UniProt: A0A3Q7W8J1
LinkDB
Position
Unknown
AA seq 555 aa
MDVMAAPALSCSLSLLVLLLALAIPRGSTVANDSSKLTCFYNSKANISCVWSWDGDPQVT
SCKIHAQPERRPWNRSCDLLLMSPAFWACHLILGSPDAQSLTAADIVNMSVMCREGDRWR
TLMTQDFKPFENLRLMAPDLLQVTHVGTHKCNITWKVPQSSHYIESYLEFEARRRSPGHS
WEEASLLVLRQNQQWICLDTLTPGTLYEFQVRVRAYLGSHKAWSPWSQPLAFRTKPAEKQ
TPLFPWFGHVIMGVSSALGFIILVYLLANCQYSGPRLKKVLKCHIPDPSEFFSQLKSEHG
GDFQKWLSSPFPSSSFSPNTQAPEISPLEVLDRDAKATQLLLLQQEKGPSPSTETSGHSL
TSCFTNQGYFFFHLPDALEIEACQVYFTYDPCTEEPEEGGPGAPEGSLLPPLRPLPAEDD
AYCTFPPGDDLLLFSPGLLGGPGPPNTALGGAGAGGEKLPPSLQEGAPRAWAPQPLEPPT
PGAPDPGDSQPPLELALREAREEVPAPGPGEGVGFPWASPSGRGQVRALTSCLTLNTDAY
LSLQELQDQDPAHSV
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggatgtgatggcagctcctgctctgtcctgctctctgtccctccttgtcctcctcctg
gccctggccatccctcggggatccacagtggcaaatgactcttccaagctcacatgcttc
tacaactcaaaagccaacatctcctgtgtctggagctgggatggggacccgcaggtcaca
tcctgcaagatccatgctcagccggagagacggccttggaacagatcctgtgacctgctc
ctgatgagcccggcattctgggcctgtcacctgatccttgggtccccagatgctcagagt
ctgacagcagctgacatcgtcaacatgagtgtaatgtgccgtgaaggcgacaggtggagg
acactgatgacccaggacttcaagccctttgagaaccttcgcctgatggcccccgacttg
ctccaagtcacccacgtcgggacccacaaatgcaacataacctggaaagtccctcagtcc
tcccactacattgaaagttacctggagtttgaggctcggagaaggtccccaggccacagc
tgggaggaggcctccctgcttgtcctcaggcagaaccagcaatggatttgcctagacaca
ctcactccaggcaccctgtacgaatttcaagtgagggtaagggcctacctaggcagccac
aaggcttggagtccctggagtcagcccctggccttcaggacgaagcctgcagagaagcag
accccgctcttcccttggtttggccacgtcatcatgggtgtcagcagcgccttgggcttt
atcatcttggtctacttgttggccaactgtcagtacagcggaccacggctgaagaaggtt
ctgaagtgccatatcccagacccctccgagttcttttcccagctgaagtcagagcatggg
ggagatttccagaagtggctgtcctcgcccttcccctcgtcatctttcagccccaacacc
caggcacccgagatctccccgctggaggtgctggacagggacgccaaggccacacagctg
ctcctgctgcagcaggagaaggggccctctccctccaccgagacgagcggccactcgctg
accagctgcttcaccaaccagggttacttcttcttccacctccccgacgccctggagatc
gaggcctgccaggtgtacttcacctatgatccctgcacagaagagcccgaggagggcggg
cctggggcgcccgaggggtctctcctcccgcccctgcgacccctgccagccgaggatgat
gcctactgcaccttcccccctggggatgacctgctgctcttctctcctggtctccttggc
ggccccggcccccccaacacggccctgggcggcgctggagctggtggagagaagctgccc
ccctcattgcaggaaggagctcccagagcctgggccccccagcccctggagcctcccacc
ccaggagctcctgacccgggggatagccagccgcccctggagcttgccctgagagaagca
agagaggaggtcccagccccaggccccggggagggagtcggcttcccctgggctagcccc
tctggacgaggccaggtcagggcccttacctcctgcctgaccctgaacaccgatgcttac
ctgtccctccaagagctgcaggatcaggacccggctcattcggtgtag

KEGG   Ursus arctos horribilis: 113249385
Entry
113249385         CDS       T05909                                 

Definition
(RefSeq) interleukin-2 receptor subunit beta-like isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113249385
   04151 PI3K-Akt signaling pathway
    113249385
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113249385
   04061 Viral protein interaction with cytokine and cytokine receptor
    113249385
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113249385
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113249385
   04659 Th17 cell differentiation
    113249385
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113249385
   05202 Transcriptional misregulation in cancer
    113249385
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113249385
   05162 Measles
    113249385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113249385
   04090 CD molecules [BR:uah04090]
    113249385
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113249385
CD molecules [BR:uah04090]
 Proteins
  113249385
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 113249385
NCBI-ProteinID: XP_026346687
UniProt: A0A3Q7W8J1
LinkDB
Position
Unknown
AA seq 555 aa
MDVMAAPALSCSLSLLVLLLALAIPRGSTVANDSSKLTCFYNSKANISCVWSWDGDPQVT
SCKIHAQPERRPWNRSCDLLLMSPAFWACHLILGSPDAQSLTAADIVNMSVMCREGDRWR
TLMTQDFKPFENLRLMAPDLLQVTHVGTHKCNITWKVPQSSHYIESYLEFEARRRSPGHS
WEEASLLVLRQNQQWICLDTLTPGTLYEFQVRVRAYLGSHKAWSPWSQPLAFRTKPAEKQ
TPLFPWFGHVIMGVSSALGFIILVYLLANCQYSGPRLKKVLKCHIPDPSEFFSQLKSEHG
GDFQKWLSSPFPSSSFSPNTQAPEISPLEVLDRDAKATQLLLLQQEKGPSPSTETSGHSL
TSCFTNQGYFFFHLPDALEIEACQVYFTYDPCTEEPEEGGPGAPEGSLLPPLRPLPAEDD
AYCTFPPGDDLLLFSPGLLGGPGPPNTALGGAGAGGEKLPPSLQEGAPRAWAPQPLEPPT
PGAPDPGDSQPPLELALREAREEVPAPGPGEGVGFPWASPSGRGQVRALTSCLTLNTDAY
LSLQELQDQDPAHSV
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggatgtgatggcagctcctgctctgtcctgctctctgtccctccttgtcctcctcctg
gccctggccatccctcggggatccacagtggcaaatgactcttccaagctcacatgcttc
tacaactcaaaagccaacatctcctgtgtctggagctgggatggggacccgcaggtcaca
tcctgcaagatccatgctcagccggagagacggccttggaacagatcctgtgacctgctc
ctgatgagcccggcattctgggcctgtcacctgatccttgggtccccagatgctcagagt
ctgacagcagctgacatcgtcaacatgagtgtaatgtgccgtgaaggcgacaggtggagg
acactgatgacccaggacttcaagccctttgagaaccttcgcctgatggcccccgacttg
ctccaagtcacccacgtcgggacccacaaatgcaacataacctggaaagtccctcagtcc
tcccactacattgaaagttacctggagtttgaggctcggagaaggtccccaggccacagc
tgggaggaggcctccctgcttgtcctcaggcagaaccagcaatggatttgcctagacaca
ctcactccaggcaccctgtacgaatttcaagtgagggtaagggcctacctaggcagccac
aaggcttggagtccctggagtcagcccctggccttcaggacgaagcctgcagagaagcag
accccgctcttcccttggtttggccacgtcatcatgggtgtcagcagcgccttgggcttt
atcatcttggtctacttgttggccaactgtcagtacagcggaccacggctgaagaaggtt
ctgaagtgccatatcccagacccctccgagttcttttcccagctgaagtcagagcatggg
ggagatttccagaagtggctgtcctcgcccttcccctcgtcatctttcagccccaacacc
caggcacccgagatctccccgctggaggtgctggacagggacgccaaggccacacagctg
ctcctgctgcagcaggagaaggggccctctccctccaccgagacgagcggccactcgctg
accagctgcttcaccaaccagggttacttcttcttccacctccccgacgccctggagatc
gaggcctgccaggtgtacttcacctatgatccctgcacagaagagcccgaggagggcggg
cctggggcgcccgaggggtctctcctcccgcccctgcgacccctgccagccgaggatgat
gcctactgcaccttcccccctggggatgacctgctgctcttctctcctggtctccttggc
ggccccggcccccccaacacggccctgggcggcgctggagctggtggagagaagctgccc
ccctcattgcaggaaggagctcccagagcctgggccccccagcccctggagcctcccacc
ccaggagctcctgacccgggggatagccagccgcccctggagcttgccctgagagaagca
agagaggaggtcccagccccaggccccggggagggagtcggcttcccctgggctagcccc
tctggacgaggccaggtcagggcccttacctcctgcctgaccctgaacaccgatgcttac
ctgtccctccaagagctgcaggatcaggacccggctcattcggtgtag

KEGG   Ursus arctos horribilis: 113253976
Entry
113253976         CDS       T05909                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin-20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113253976 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113253976 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113253976 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113253976 (IL20RB)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL10/28 receptor family
   113253976 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 113253976
NCBI-ProteinID: XP_026352884
UniProt: A0A3Q7WEY7
LinkDB
Position
Unknown
AA seq 380 aa
MQYWVWTERGELHSPPLLSLLGCLLFLEQFSLQGSSDLSSNICILKQGWLRWTECFILEG
NYVPGRAESANTDPLVVLEEILTSLIMWFFYALIPCLLIGGVAILPAPQNLSVQSTNMKH
LLMWSPVIVPGEIIYYFVEYQGEYESLYMSHIWIPSSWCSPTEGPECDITDDVTATVPYN
LRVRATVGAQTSAWSTLQHPFNRNSTVLTPPVMEVTKDGFHLVIKLEDLGPQFEFLVAYW
RREPGAKEHVKVVKSRGIPVHLGTMEPGAAYCVKVRTFVKAIGRHSPFSQAECVKVQGET
LPLTLALFAFVGLMLILVVVPVSVWKMGRLLRYSCCPVVVLPDTLKITNSPQKLISCRRE
EVEACATAVLSSEEPFRAWI
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgcaatactgggtttggacagaaaggggggagctgcatagcccgccccttctgagcctt
ctgggctgcctcctttttctagaacaattcagtcttcagggcagctcagacctcagctcc
aacatctgtattctgaagcaaggatggctgagatggactgaatgcttcattctggaagga
aactatgtcccaggtcgagctgaatctgccaacacagaccctcttgtggttttagaagaa
atcttgacaagtcttatcatgtggtttttctacgccttgattccttgtttactcataggt
ggagtggccatcctgcctgcgcctcagaacctctctgtacaatcaaccaacatgaagcat
ctcttgatgtggagcccagtaattgtgcctggagaaataatatactattttgtcgagtac
cagggagaatatgagagcctgtacatgagccacatctggatccccagcagctggtgctca
cccaccgaaggtcctgagtgtgacatcaccgatgacgtcactgccactgtgccatacaac
ctccgtgtcagggccaccgtgggcgcacagacctcagcctggagcaccctgcagcatccc
tttaaccgaaactcaaccgtcctcacaccacctgtgatggaggtcaccaaggacggcttc
cacctggttattaagctggaagacctggggccgcagtttgagttcctcgtggcttactgg
aggagggagcctggtgccaaggaacatgtcaaagtggtgaagagcaggggcattccggtg
cacctgggaaccatggaaccaggggctgcatactgtgtgaaggtccggacgttcgtgaag
gccattgggaggcacagccctttcagccaggcagagtgtgtcaaggtgcaaggagagacc
ctcccgctgacgctggccctgtttgcgtttgttggcctcatgctgatccttgtggtcgtg
cccgtttccgtctggaaaatgggccggctgctccggtactcctgttgccccgtggtggtg
ctccccgacaccttgaaaataaccaattcaccccagaagttaatcagctgcagaagggaa
gaggtggaagcctgtgccacagccgtgctgtcttctgaggaacccttcagggcctggatc
tag

KEGG   Ursus arctos horribilis: 113254551
Entry
113254551         CDS       T05909                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2
  KO
K05064  interleukin 12 receptor beta-2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254551 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113254551 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113254551 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113254551 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113254551 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113254551 (IL12RB2)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113254551 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 113254551
NCBI-ProteinID: XP_026353632
UniProt: A0A3Q7WT32
LinkDB
Position
Unknown
AA seq 862 aa
MAHTVGGCSLALIFIIVLLLVKANIDACKRGDVTVEPSHVISLGSAVNISCSLKPEQGCP
QYSSLNRLILYKVNEKINLLHGHFLSSQVTDLPLGTTVFFCKLACSKKKELRICGAEISV
GVVPEQPQNLSCIQKGERGTVNCTWDRGRDTHLYTTYTLQLNGPKNLTWQKQCNGHYCDH
LDLGVNLIPELPESSYTAKVTATNRLGNASSFPSTFTFWDIVRPLPPCDIRIKCVNASVS
RCILQWSDEGLVLLNRLRYRPNSSWSWKMVSATNVKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRTQTPEEEPTGTLDVWYMKQHIDYSRQQISLFWKNMSLSEARGKILHY
RVTLQEVAGGKVTLQNITEHTSWTWVIPRTGNWVVTVSAANSKGSSLPTRINITDLLGPG
LPAPRQVSANSKGGDNIMVTWEPPGKAAPAVQEYVVEWRELHPRGGTQPPLNWLRTTPYN
VSALISENIKPYSCYEISVYALSGDQRGGSSIRANSKHKAPLSGPHINAISEEKGSVLIS
WNEVPAQEQMGCLLHYRIYWKEQDSNSQPQLCEIPYRVSLNSHSIDSLQPRVTYVLWMTA
LTAAGESPPGNKREFCLEGKASWSVFVAPSICIAVVIVGIFSMRYFRQKVFVLLSALRPQ
WCSKEIPDPANSTWAKKYPIVEEKTQLPLDRLLTDWPNPEEPETLVITEVLHQVTPVFRH
PCHPNWPDKGQGVQGHYTSEEDTGYSASSLPPSKALIAETGQLVDLYKMLGSRGPDSKPG
HLVSPLTALPVDYLPTHEGYLPANIEYLPSHEVPVTDPLEELEPQHISLSVFPSSSLHPL
TFSCDKKLTLDRLKMGCSSLML
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggcacatacagttggagggtgctcattggcacttatttttatcattgtgttgttgttg
gttaaagcaaatatagatgcatgcaagagaggagatgtgactgtggagccttcccatgta
atttcacttggatcagctgtcaatatttcatgctctttgaagcccgaacaaggctgccca
caatattccagtttaaacaggttaatcctctacaaggttaacgaaaaaatcaatttgctg
catggtcacttcctcagttctcaagtcacagatcttcctctgggtacaacagtgtttttc
tgcaaactggcctgtagcaaaaagaaggaattgcgaatatgtggggcagagatctcagtt
ggtgttgttccagaacagcctcaaaacttatcttgtatacagaagggagaacgtgggact
gtgaactgcacctgggacagaggaagagacacccatctatatactacgtatactttacag
ttaaatggaccaaaaaatttaacatggcagaagcaatgtaatggtcattattgtgaccat
ttggaccttggagtcaacctaatccctgaattgcctgaatccagctacacagccaaggtc
actgctaccaatagacttggaaatgcttcttcgtttccatccacatttacattctgggac
atagtgaggcctcttcctccatgcgacatcagaatcaaatgtgtaaacgcttctgtgagc
agatgtatccttcagtggagcgacgaggggctggtgctgcttaatcgactcagatatcgg
cccaacagcagctggtcctggaaaatggtcagtgctacaaatgtcaaaggaagacatgat
ttgctggacctgaaaccatttacagagtatgaatttcagatttcctctaagctacatcta
tataaaggtagttggagtgattggagtgaatcgttgagaacacaaacaccagaagaagag
cctacagggacattggatgtctggtacatgaaacagcacattgactacagtagacaacag
atttctcttttctggaagaatatgagtctatccgaggcaagaggaaaaatcctccactat
cgcgtgaccttgcaggaggtggcaggggggaaagtcacactacagaacatcacagaacac
acctcctggacctgggtcattcctagaactgggaattgggttgtaactgtgtctgcagct
aactcaaaaggcagttccctgcccactcgtattaacataacggacctgcttgggccaggg
ttgccggctcctcgccaggtgtctgcaaactcgaagggtggggacaacattatggtgacg
tgggagcctccagggaaagctgcacctgctgtccaggagtatgtggtggaatggagggaa
cttcatcccaggggtggcacgcagccccctctgaactggctgcggactaccccctacaat
gtgtctgctctgatttcagagaacataaagccctacagctgctacgaaatcagcgtgtat
gcgctgtcgggggaccagagaggaggcagctccatccgggctaactctaaacacaaagca
ccactgagtggcccccacattaatgccatctcagaggaaaaggggagtgtattaatttca
tggaatgaagttccagcccaggagcaaatgggctgcctcctccattatagaatatactgg
aaggaacaggactccaattcccagcctcaactttgtgaaattccctatagggtatcccta
aattcacattcaatagacagcctgcagcccagagtgacatatgtcctatggatgacagct
ctgacagctgctggtgaaagcccgccaggaaacaagagggaattttgtctggaaggtaaa
gccagttggagtgtgtttgtggcaccaagcatttgcattgctgtcgtcatagtgggcatt
ttctcaatgcgttacttccggcaaaaggtatttgttcttctttcggccctcagacctcag
tggtgtagtaaagaaattccagacccagcgaacagcacctgggccaagaaatatcccatc
gtggaggagaagacgcagctgcccttggacaggctcctgacagattggcccaatcctgaa
gaacctgagaccctggtcatcaccgaagtccttcatcaagtgaccccagtcttcagacat
ccctgtcaccccaactggccggacaaaggacaaggagtccaaggtcactacacctctgag
gaagacacagggtacagtgcctcaagcctaccaccttcaaaagctctcatagcagagaca
ggacaactagtggatctgtacaagatgctggggagcaggggccctgactcaaagccagga
cacctagtcagccccttgacagccctcccagtggactaccttcccacccatgagggatac
ttacccgccaacatagagtatctcccttcacatgaggttcctgtaactgaccctctggaa
gaactagagcctcagcacatctctctctctgttttcccttcaagttcccttcacccactc
accttctcctgtgataagaagctgactctggatcggttaaagatggggtgcagctccctc
atgctgtaa

KEGG   Ursus arctos horribilis: 113254554
Entry
113254554         CDS       T05909                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254554 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113254554 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113254554 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113254554 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113254554 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113254554 (IL23R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113254554 (IL23R)
SSDB
Motif
Pfam: IL6Ra-bind fn3 IL12p40_C Lep_receptor_Ig PriX
Other DBs
NCBI-GeneID: 113254554
NCBI-ProteinID: XP_026353637
UniProt: A0A3Q7WT38
LinkDB
Position
Unknown
AA seq 631 aa
MNQVTIQWDVIIALYIFFNWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLYFYKNGIKERFQVTRINKTTARLWYNNFLEPHASMYCTAECPGYFQETLICGKDIS
AGYPPDVPDKVTCVIYEYSGNMTCTWNSGKPTYIDTKYVVYVKSLETEEEQQYLSSSYIN
ISTDSLQSGKKYLVWVQAANALGMENSKQLQINLDDIAIPSASIISRAEFINTTMPKTII
HWHSQTAIKNISCEMRYKATTNQTWKVKKFDTNFTYEQQSEFYLESNTNYIFQVRCQETG
KKYWQPWSSPFSHKTAETVPQITWKSFQHDTQNSEHLIASIFKGHLTSDNRQQDIRLLSG
MVFFAVMLSIISLIGILNRSLRTGIKRRILLLIPKWLHEDIPNVENSNVVKMLQEKSEFM
NNNSSEQVLYVDPVITEIEIFLPEEHKPMDYKTEENTGSLETRDCQQKSLLTNTTVVYIP
GLSTGYKPQISNFLTGGNHLSKNDDTSSSTLKPPADSLDLGENARFKKYPNFAFSVSSMN
SLSNTLFLEELSLILNQGEHSPLDMQNSVEGETTMLLEDASSNKTIPEQTLLPDEFVSCL
GAMNEELPSINSYFPQNILENHFNTISLLEK
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaatcaggtcacaattcaatgggatgtgataatagctctttacatattcttcaactgg
tgtcatggaggaattacaaatataaactgctctggccacatctgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatactgtcaagcagcaattaagaactgccaa
ccaaggaaactttatttttataaaaatggcatcaaagaaagatttcaagtcacaagaatt
aacaaaacgacagctcggctttggtataacaactttctggagccacatgcttctatgtac
tgcactgctgaatgtcctggatattttcaagagacactgatatgtggaaaagacatttct
gctggatatccaccagacgttcctgacaaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgtacctggaactccgggaagcccacctacatagacacaaagtatgtggtg
tacgtgaagagtttagagacagaagaagagcaacaatatctttcttcaagttatattaac
atctccactgattcattgcaaagtggcaagaaatatttggtgtgggtccaagcggcaaat
gcattgggcatggagaactcaaaacaactgcaaattaatctggatgatatagcgatacct
tctgcatccatcatttccagggctgagtttataaatactacaatgcccaagaccataatt
cactggcatagtcaaacagcaattaaaaatatttcctgtgaaatgagatacaaggctaca
acaaaccaaacatggaaggttaaaaaatttgataccaattttacatatgagcaacagtca
gaattctacttggagtcaaacactaattatatatttcaagtgagatgccaagaaacaggt
aaaaagtactggcagccctggagttcacccttttctcataaaacagctgaaacagttccc
cagatcacatggaaatcattccaacatgatactcagaattctgagcatctaattgcttcc
atctttaaaggacatcttacttctgacaacaggcaacaagacattagacttttatcagga
atggtcttctttgctgttatgttgtcaattatttctttgattgggatattaaacagatca
ctgcgaactggaattaaaagaagaatcttattgctaataccaaagtggcttcatgaagat
attcctaatgtggaaaacagtaatgttgtaaaaatgctacaggaaaaaagtgaatttatg
aataataattctagcgagcaggtcctttatgttgatccggtgattacagagatagaaatc
tttcttccagaagaacacaagcccatggactacaagacagaagagaatacaggatccctg
gagacaagagactgccagcagaagtcactactcaccaacactacagttgtgtatattcct
ggtctcagcactgggtataaaccccagatttcaaattttctcactgggggaaaccatctc
agcaaaaatgatgacacatcttcctcaactctcaaaccaccagctgattccttagaccta
ggggaaaatgccaggtttaaaaaatacccgaattttgctttttctgtctcaagtatgaat
tcgctaagcaacacactatttcttgaagaattaagcctcattttaaatcaaggagaacac
agtcctctggacatgcaaaactcagttgaaggagaaactaccatgcttttggaagatgct
tcatccaacaaaactattccagaacagaccctgttgcccgatgaattcgtttcctgtttg
ggggccatgaatgaggagttgccatctattaattcttattttccccaaaatattttggaa
aaccacttcaatacgatttcactcttggaaaagtag

KEGG   Ursus arctos horribilis: 113254563
Entry
113254563         CDS       T05909                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor isoform X1
  KO
K05062  leptin receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04080  Neuroactive ligand-receptor interaction
uah04152  AMPK signaling pathway
uah04630  Jak-STAT signaling pathway
uah04920  Adipocytokine signaling pathway
uah04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254563 (LEPR)
   04152 AMPK signaling pathway
    113254563 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113254563 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    113254563 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113254563 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113254563 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113254563 (LEPR)
   04090 CD molecules [BR:uah04090]
    113254563 (LEPR)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  Prolactin receptor family
   113254563 (LEPR)
CD molecules [BR:uah04090]
 Proteins
  113254563 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 113254563
NCBI-ProteinID: XP_026353672
UniProt: A0A3Q7WT78
LinkDB
Position
Unknown
AA seq 1166 aa
MTCQKFSVALLHWEFIYLTTAFNLAYPITPWRFKLSCMTPNTTYDFLLPTGISKNTSNLN
EHNEAVVEDKLNSSSTYFSNLSSKTTFHCCFWSKEEKNCSVHADNTEGKAFISTVNSLVF
QQIGANWNIQCWMKEDLKLFICYMESLFKNPFKTYDLKVHLLYVLPEVLDESPPVPQKGS
FQIVQCNCSVHDSCECQVPVPTAKLNHTLLLYLKITSGGINFQSPLMSVQPINVVKPDPP
LDLHMEITDAGNLKISWSSPTLVPFQLQYQVKYSENSSTNMRKADEIVSATSLLIDSVLP
GSSYEVQVRGKRLDGPGIWGDWSTPLIFTTQDVIYFPPKILTSVGSNVSIHCIYKNENEI
VSSKKIVWWLNLAEKIPASQYMVLGDRVSKVTFPNLNATRPRGKFTYDAVYCCNQQECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSTNAIQSLMGSTLQLRYHRSSLYCSDVPSIH
PISEPKDCHLQRDGFYECIFQPIFLLSGYTMWIKINHSLGSLDSPPTCVVPDSVVKPLPP
SSVKAEITVKIGLLKISWEKPVFPENNLKFQIRYGLNGKEVQWKIYEVYDAKSKSASVLV
PDLCAVYAVQVRCQRLDGLGYWSNWSSPAYTVVMDIKVPTRGPEFWRIINEDTTKKERNV
TLLWKPLMKNDSLCSVRKYVVKHHTSRNGTWSEDVGNHTKFTFLWTEQGHSVTVLAVNSI
GASFVNFNLTFSWPVSKVNTVQSLSAYPLNSSCVLLSWTLSPSDYYLMYFVTEWKILNED
SEIKWLRIPPSVKKYYIHDHFIPIEKYQFSLYPVFMEGVGKPKIINSFTQDDIEKHQHDA
GLYVIVPIIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFI
KHTESVIFGPLLLEPETISEDISVDTSWKNKDEMVPTTMVSLLLTTPDLEKGSLCIRDQN
TSANFSELESTVIAREDESRRQPSVRYATLLGSSKSSEIDEEQGLINSSVSKCFSSKHSL
PKGSFSNSSWEIETQAFFILSDQHPNIISPHLPFSEGLDELLKLEGNFPEENNGERSVYY
LGVTSIKKRESGVFLTDESQVLCPFPAHCLFTDIRILQDSCSHLVENNFNLGTSGQKTFV
SYMPQFQICSTQTQKIMENKMCDLTV
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgacttgtcaaaaattctctgtggctttgttacattgggaatttatttatttgacaact
gcctttaacttggcatatccgattactccctggagatttaagctgtcttgcatgacacca
aacacaacctatgacttcctcttgccaactggaatctcaaagaacacttccaatttgaat
gaacataatgaggcggttgtcgaagataaattgaattcgagtagtacctacttctctaac
ttatcttccaaaacaactttccactgttgcttttggagcaaggaagagaaaaactgttct
gtacatgcagacaacactgaagggaaggcatttatttcaacagtgaattctttagttttt
caacaaataggtgcaaactggaacatacagtgctggatgaaagaggacttgaaattattc
atctgttatatggagtcattatttaagaatcctttcaagacttatgaccttaaggtccat
cttttatatgttctgcctgaagtgttagacgagtcacctccggtcccccagaaaggcagc
tttcagattgttcagtgcaactgcagtgttcacgacagctgtgaatgccaggtgcctgtg
ccgacagccaaactcaaccacactctccttctctatttgaaaatcacatctggtggaata
aattttcagtctcctctaatgtcagttcagcccataaacgttgtgaagcctgatccccca
ttagatttacatatggaaatcacagatgccggcaatttaaagatttcttggtccagccca
acactggtaccatttcaacttcaatatcaagtgaaatattcagagaattcttcaacaaat
atgagaaaagctgatgaaattgtctcagctacgtctctgctgatagacagtgtgcttcct
gggtcttcatacgaggttcaagtgaggggcaagagactggatggaccaggaatctggggt
gactggagcacccctcttatctttaccacacaagatgtcatatactttccgcctaaaatt
ctgacaagtgtcgggtctaatgtttctattcactgcatttataaaaatgaaaacgagatt
gtttcctcaaaaaagattgtttggtggctgaatttagctgagaaaatccctgcgagccag
tatatggttctgggtgaccgtgttagcaaagtcacttttccaaatctgaatgcgaccagg
cctcgcgggaagttcacctacgacgcagtgtactgctgcaaccagcaggagtgccaccat
cgctatgcggaattatacgtgattgatgtcaatatcaatatatcatgtgaaactgatggg
tacttaactaaaatgacttgcagatggtcaaccaatgcaatccaatcactcatgggaagt
actttgcagttgaggtatcataggagcagcctttactgttctgatgttccatctattcat
cccatatctgaacccaaagattgccatttgcagagagatggtttttatgaatgcatattt
cagccaatctttctattatccgggtatacaatgtggattaaaatcaatcactctttgggt
tcacttgactctccaccaacgtgtgttgttcctgattccgtggtgaaaccactgcctcca
tccagtgtgaaagcagaaattactgtaaaaattggattattgaaaatatcttgggaaaaa
ccagtctttccagagaataatcttaagttccagattcgctatggcttaaatggaaaagaa
gtacagtggaagatatatgaggtgtatgatgcaaaatcaaaatcggccagtgtcctggtg
ccagacctgtgtgccgtctatgctgtccaggtgcgctgccagaggctggatgggctgggg
tactggagtaattggagtagtccagcctacactgttgtcatggatataaaagttcctacc
agaggacctgagttttggagaataattaatgaagacacgactaaaaaagagagaaatgtt
actttactttggaagcctctgatgaaaaatgactcattgtgcagtgtgagaaaatatgtg
gtaaaacatcatacttcccgcaatggaacatggtcagaagatgtgggaaatcacactaaa
ttcactttcctgtggacagaacaaggacattctgttacagttctggctgtcaattcaatt
ggtgcctcttttgtgaattttaatttaaccttctcatggcctgtgagcaaagtaaatacc
gtgcagtcgctcagtgcttatcctttaaacagcagttgtgtgcttctctcctggacgcta
tcacccagtgactactatctgatgtattttgttactgagtggaaaattcttaatgaagac
agtgaaattaaatggcttaggatccctccatctgttaagaagtattatatccatgatcat
tttatccccattgagaagtatcaattcagtctttacccagtatttatggaaggagtgggg
aaaccaaagataattaatagtttcacccaagatgatattgaaaaacaccagcatgatgca
ggtctatatgtaattgtgccaataattatttcctcttcaatcttactgcttggaacgttg
ttaatatcacaccaaagaatgaaaaagctgttttgggaagatgttccaaaccccaagaac
tgttcctgggcacaaggacttaattttcagaagccagaaacatttgagcatctttttatc
aagcatacagaatcagtgatatttggtcctcttcttttggagcctgaaaccatttcagaa
gatatcagtgttgacacatcatggaagaataaagatgagatggtgccaacaactatggtc
tctctgctcttgacaactccggatcttgaaaagggttctctttgtatccgtgaccagaac
accagtgctaacttctctgagctggagagcaccgtgatagcccgtgaggatgaaagcagg
aggcagccctctgttagatatgccaccctcctcggcagctctaaatcaagtgaaattgat
gaggagcaagggcttataaacagctcagtcagcaaatgcttctctagcaaacattctcta
ccaaagggttctttctccaacagctcatgggagatagaaacccaggcattttttatatta
tctgatcagcatcccaatataatttcaccacaccttccattctcagaagggttggatgaa
ctcttgaaacttgagggaaatttccctgaagaaaataatggtgagaggtctgtctattat
ttaggggtcacctcaatcaaaaaaagagagagtggtgtgtttttgactgatgagtcccaa
gtgttgtgtccgttcccagcccattgtttgttcactgacatcagaatcctccaggacagt
tgctcacaccttgtagagaataacttcaatttaggaacctctggtcagaagacttttgta
tcttacatgcctcaatttcagatttgttccactcagacccagaagataatggaaaacaaa
atgtgtgacctaactgtctaa

KEGG   Ursus arctos horribilis: 113254790
Entry
113254790         CDS       T05909                                 

Gene name
MPL
Definition
(RefSeq) thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254790 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113254790 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113254790 (MPL)
   04090 CD molecules [BR:uah04090]
    113254790 (MPL)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  Prolactin receptor family
   113254790 (MPL)
CD molecules [BR:uah04090]
 Proteins
  113254790 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind LapA_dom
Other DBs
NCBI-GeneID: 113254790
NCBI-ProteinID: XP_026354094
UniProt: A0A3Q7WIQ4
LinkDB
Position
Unknown
AA seq 680 aa
MPSWALLVVTSCLLLAPQNLAQVTSQDASFLASDAEPLNCFSRTFEDLTCFWDEEEAAPN
GTYQLLYAYPGEKPRACPLSFKSVPPFGTRYVCQFPAQDEVRLFFPLHLWVKNVFLNQTL
TQRVLFVDSVGLPAPPDIIKASGGSQPGELQISWETPAPEISDFLRHELRYGPKDPRNSI
GPTVMQLLPTETCCPVLQRLNPVPALHQPPCAQPMMPQQDGPEQTSPTREASSLTVRSGS
CLISGLQPGKSYRLQLRSQPDGVSLLGSWGSWSLPATVDLPGDAVEIGLQCFTLNLKNVT
CQWQQQDHASSQGFFYHSKARCCPRDRDPVWEKCEEEKTPGFQPSQFSRCHFRSRNDSVI
HILVEVTTAQGAVHSYLGSPFWIHQAVLIPTPNLHWREVSSGQLELEWQHPSSWGAQETC
YQLRYTGEGHQDWKVLEPPLGAQGETLELRPRSRYRLQLRARLHGPTYQGPWSAWSDPVP
VETTSDTAWISLVTALLVALGLSALLGLLLLRWQFPARYRSLKHALWPSLPDLHRVLGQY
LRDTAALSPPKAAVSDAFEDVEPSPLEILPKSSEKISVALCSSQAQMDYRGLPPSCLGTM
PLCVCPPMAESGSYCTTHIANHSYLPLSCWQAPLSPYPGQIQTRQTSFPNLPTHPSPTTQ
TSQTSRPSPSVCPHSWAPRH
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcttggtggtcacctcctgcctcctcctggccccccaaaacctg
gcacaagtcaccagccaagatgcctcctttctggcctcggatgcagagcccctgaactgt
ttctctcgaacatttgaggacctcacttgcttctgggatgaggaagaggcagcacccaat
ggaacataccagctgctgtatgcgtacccaggggagaagccccgtgcctgccccctgagt
ttcaagagcgtgcccccctttgggacccgatacgtgtgtcagtttccagcccaggatgaa
gttcgcctcttctttccattgcacctctgggtgaagaacgtgtttctgaaccagactctg
acccagcgagtgctctttgtggatagtgtgggcttgccagctcccccagatatcattaag
gcttcgggcgggagccagccaggggaacttcagatcagctgggagaccccagctcccgaa
atcagtgatttcctgaggcacgaacttcgctatggccccaaggatcccaggaattccatt
ggtcccacagtcatgcagctgctgcccacagaaacctgctgtccggttctgcagagacta
aacccagtcccagctctgcaccagcctccatgtgctcagcccatgatgccccaacaggat
ggaccagagcagacctccccaactagagaagcttcatctctaacagtgaggagtggaagc
tgcctcatctcagggctccagcctggtaaatcctacaggctccagctgcgcagccaaccc
gatggggtctccctccttggctcctggggatcctggtccctccctgcaactgtggacctg
cctggagatgcagtggaaattggactgcagtgctttaccttgaacctgaagaatgttacc
tgtcagtggcagcaacaggaccatgctagctcccaaggcttcttctaccacagcaaggca
cggtgctgccccagagacagggaccccgtctgggagaagtgtgaagaggagaaaacccca
ggattccagccctcccagttctcccgctgccacttcaggtcacgaaacgacagtgttatt
catatccttgtggaggtgaccacagcccagggtgctgttcacagctacctgggctcccct
ttctggatccaccaggctgtgctcatccccactccaaacttgcactggagggaggtctcc
agtgggcagctggaattggaatggcaacacccatcatcctggggagcccaagagacctgc
tatcagctccgatacacaggagaaggccatcaagactggaaggtgctggagccgcctctc
ggggcccagggagagaccctggagctgcgcccgcgctcccgctaccgcttgcagctgcgc
gccaggctccacggccccacctaccaaggcccctggagcgcctggtccgacccagtgccg
gtggagaccacctcggacaccgcctggatctccttggtgaccgccctgctcgtggcgctc
ggcctcagcgccctcctgggcctgctgctgctgagatggcagtttcctgcgcgctacagg
agcctgaagcatgccctgtggccctcacttccagacctgcaccgggtcctaggccagtac
cttagggatacggcagcactaagtccgcctaaggctgcagtctcagatgcctttgaggat
gtggaacccagcccccttgaaattctacccaagtcctcagagaagatctccgtggccctg
tgttcctcccaggcccagatggactaccgaggattgcccccttcttgcctggggaccatg
cccctgtgtgtgtgcccacccatggctgagtcggggtcctactgcaccacccacatcgcc
aaccattcctacttacctctgagctgttggcaggcccctctctccccgtaccctggacag
atccaaacccgccagacttcttttcccaacctccctacccaccccagccccacaacacaa
acatctcagacctcacgtccatccccctctgtctgtcctcatagttgggctccccgacac
tga

KEGG   Ursus arctos horribilis: 113255323
Entry
113255323         CDS       T05909                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta isoform X1
  KO
K05060  interleukin 6 signal transducer
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05200  Pathways in cancer
uah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113255323 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113255323 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113255323 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113255323 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113255323 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255323 (IL6ST)
   05203 Viral carcinogenesis
    113255323 (IL6ST)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    113255323 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113255323 (IL6ST)
   04090 CD molecules [BR:uah04090]
    113255323 (IL6ST)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113255323 (IL6ST)
CD molecules [BR:uah04090]
 Proteins
  113255323 (IL6ST)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 113255323
NCBI-ProteinID: XP_026354730
UniProt: A0A3Q7VR71
LinkDB
Position
Unknown
AA seq 918 aa
MLALQTWIVHALFIFFTTESVGELLDPCGFIKPESPVVQLGSNFTAVCVLKEKCMDYFHV
NASYIFWKTNHLTVPKEQYTIINRTASSVTFTDTSLLNTQLTCNIRTFGQIDQNVYGIRI
ISGLPPEKPKNLSCIVNEGKKMMCQWDPGRETYLETNFTLKSEWATEKFADCKTKRDTPT
SCTVDYSPVYFVNIEVWVEAENVLGKVTSDHINFDPVDKVKPNPPHNLSVSNSEELSSIL
KLTWINSSIQGFIRLKYNIQYRTRDASIWNQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGFWSDWSEEASGITYEDRPSKAPSFWYKIEPSHTHGYRAVQLIWKTLPPFEAN
GRILDYEVTLTRWKSRLQNYTVNDTKWTVNITNDRYIATLTARNLVGKSDAAVLTIPAYD
FQATRPVTDLKAFPKDNMLWVEWTAPNESVNRYVLEWCVLSDKSPCVPDWQQEAGSVHRT
YLRGNLAESKCYLITVTPIYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SLIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEAANDKKPFPEDLKSLDLFKKEKV
STEGHSSGIGGSSCMSSSRPSISSSDENECAQNTSGAVQYSTVVHSGYRHQVPAVQVFSR
SESTQPLLDSEERPEDLQLLDNTESSVGNFPRQQYFKQNCSQRETSPDSSHFERSKQVSS
VNEEEFVRLKQQISGISQPYGSGQMKMFQEISVADAFGPRTEGQVERLETVGMEAAVDEG
MPKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttggcattgcaaacttggatagtgcacgcattgtttattttcttcaccactgaatct
gtaggtgaacttctagatccatgtggttttatcaaacctgaatctccggttgtgcagctt
ggctctaatttcactgcagtttgtgtgctaaaagaaaaatgtatggattattttcatgta
aatgctagttacattttctggaaaacaaaccatcttactgttccgaaagagcaatatacc
atcataaacagaacggcatctagtgtcacgtttacagatacatctttactaaatactcag
ctcacttgcaacattcgtacatttggacagattgatcagaatgtttatggaatcagaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaatgaaggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacatacctggaaacaaacttcacttta
aaatctgaatgggcaacagagaagtttgctgattgtaaaacaaaacgtgacacccccacc
tcatgcactgttgattattctcctgtgtattttgtcaacattgaagtctgggtagaagca
gagaacgtccttgggaaggttacatcagatcatataaattttgatcctgtagataaagtg
aagcccaatccgccacataatttatctgtaagcaactcagaggaactgtccagtatctta
aaattgacgtggatcaactcaagtattcagggttttataagactgaaatataacattcaa
tataggaccagagatgcctcaatttggaaccagattcctcctgaagatacagcatccacc
cgatcttcattcactgtccaggaccttaaaccttttacagaatatgtgtttaggattcgt
tgtatgaaggaagatggtaaaggattctggagtgactggagtgaagaagcaagcggtatc
acatatgaagatagaccatccaaggcaccaagtttctggtataagatagagccatcccat
actcatggctatagagctgtgcaactcatatggaagacattgcctccttttgaagccaat
ggaagaattttggattatgaagtgacacttacaagatggaaatcacgtttacagaattac
acagttaatgacacaaaatggacagtaaacatcacgaatgatcgttatatagcaactctc
acagcaagaaatctcgttggcaagtcagatgcagctgttttaactatccctgcttatgac
tttcaagctactcggcctgtaacggatcttaaagcatttcccaaagataatatgctttgg
gtagaatggactgctccaaatgaatctgtgaacagatacgtacttgagtggtgtgtgtta
tcagataaatcgccctgtgtcccagactggcagcaggaagctggctctgtacaccgcacc
tatttaagagggaacctagcagagagcaaatgttacttgataacagttactccaatatat
gctgatggaccaggaagcccggagtctataaaagcataccttaaacaagccccaccttcc
aaaggacctactgttcggacaaaaaaagtggggaaaaatgaagctgtcttagagtgggac
caacttcctgttgatgttcagaatggatttatccgaaattatactatattttatagaacc
atcattggaaatgaaaccgccgtgaatgtggattcttcgcacacagaatatacattgtcc
tctctgaccagtgacactttgtacatggtacgaatggcagcatacacagacgaaggtgga
aaggacggcccggaattcactttcaccacaccaaagtttgctcaaggagaaattgaagcc
atagttgtgcctgtttgcttagcgttcctattgacaacccttttgggagtattgttctgc
tttaataagcgagacctaattaaaaaacatatctggcctaatgttccagatccttcaaag
agtcttattgcccagtggtcacctcatacaccccctaggcataattttaattcaaaagat
caaatgtattcagatggcaatttcactgatgtaagtgttgtggaaatagaagcagcaaat
gacaaaaagccttttccagaagatctgaaatcactggacctgttcaagaaggagaaggtt
agcactgaaggacacagcagtggtattggagggtcttcctgcatgtcctcctccaggccc
agcatttcgagcagcgatgaaaatgagtgtgcacagaacacttcgggcgccgtccagtac
tccacggtggtgcacagtggctacagacaccaggtcccggcagtccaagtcttctcaaga
tccgagtccacccagcctttgttagattctgaggagcggccggaagatctacagctgtta
gataacacagagagcagtgtcggcaatttccccaggcaacagtatttcaaacaaaactgc
agtcagcgtgaaaccagcccagatagttcacattttgaaaggtcaaagcaagtttcatca
gtcaatgaagaagagtttgtgagactcaaacagcagatttcaggtatctcacagccctat
ggatccgggcaaatgaaaatgtttcaggaaatttctgtagcagatgcttttggcccacgt
actgagggacaggtagagagacttgaaacagtggggatggaggctgcagttgatgaagga
atgcccaagagttacctcccgcagactgtccgacgcggtggctacatgcctcagtga

KEGG   Ursus arctos horribilis: 113255980
Entry
113255980         CDS       T05909                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04210  Apoptosis
uah04630  Jak-STAT signaling pathway
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113255980 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113255980 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113255980 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255980 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113255980 (CSF2RB)
   04090 CD molecules [BR:uah04090]
    113255980 (CSF2RB)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL3 receptor family
   113255980 (CSF2RB)
CD molecules [BR:uah04090]
 Proteins
  113255980 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind IL4Ra_N fn3 EpoR_lig-bind IL2RB_N1 Tissue_fac Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 113255980
NCBI-ProteinID: XP_026355462
UniProt: A0A3Q7W2I2
LinkDB
Position
Unknown
AA seq 902 aa
MVLIRGLLPVVLLALFWGPSVAGAQETVPLQTLSCYNDYKSLITCRWANTQGAQPLISLT
LYRRLNEDPPKPVSCDLSNDTALLDRPCPGCVSRRCVIPYEFFVIADRDYFSFRPDRPLG
TQLTITLTQHVQAPEPKDLLINTTGDRFLLTWTVALPGPQSRWLSRLEYEVVYKRLQDSW
EEASTLQVNSSQAVLEPEHLIPSSTYVARVRTHLAPSSGLSGRPSPWSPEVLWHSQTGDK
AQPQNLQCFFDGASVLSCSWEVRSEVASSVSFALFYKTSPNAGEEECSPVLKEELPGLYV
RHRCQIPVPDPGNHSQYTVSVRPKEEEKFIKSSDNIQMAQPAVNVTKSRDGYTLHWTAKE
MFYKHIGHTFQVQYKTDAASWEESKTETLQNAHSMSLPPLEPSTRYRARVRVEPTPSGYR
GIWSDWSEECFWDTEWVLPTWVLVLILVFTTLALLPALRFCGMYGYRLNRKWEEKIPNPS
KSHLFQNGSAGLQLPGSMSALVSMSPPHKGPQGSLFPELDGVFPVNYRHSEVSPLTMEDP
KDARESPCEPDATPASSDLLAEQACGPQPGPSAPASRPESQGSGFDFNGPYLGLPHSHSL
PDVLGQPAPPQAGVSQKPQPPGALEYLCLPAGGRVQLVPLAQVMAQGQAKDLDRTPGPEA
EGSPSLESGAGLAPSAPGLMVGGQGAKNSPSAKDVVLTARPPGSRGPEGGFLASGYVTTT
DLALPLPTELPSVSTVHPGHLPSDQNQSLSLGGAGGPHAAPAPGKPEIEGYVDVPPTPGQ
SSKPALGDPAPPTASSSMLSPAEPRAEGAPPSPHPEGLLVLQQVGDYCFLPGLGSGSLSP
QTKPSSPGPCPEIGDHDQVFQAKKALGQAVPQMPAIRHFKALQQQDYLSLPPWDVGRPEE
VR
NT seq 2709 nt   +upstreamnt  +downstreamnt
atggtgctgatccgggggctgctccccgttgtcttgctggctctgttctgggggcccagc
gtggcaggggcccaagagaccgtcccactgcaaaccctgagctgctacaatgactacaag
agcctcatcacctgcaggtgggcaaacacccagggcgcccagccgctcatcagcctgact
ctctaccggaggctgaacgaggaccctccaaagcctgtgtcctgtgatctcagtaacgac
actgccttgttagaccgcccgtgtcccggctgtgtgtctagaagatgtgtcattccctat
gagtttttcgtcattgctgacagagactacttctcattccgaccggaccggcctctgggc
acccagctcaccattactctgacccagcatgtgcaggcacctgagcccaaggaccttctg
atcaatactaccggggaccgcttcctgctgacctggacggtggcccttccaggtccccag
agccgctggctgtccaggctggagtatgaggtggtctacaagaggcttcaggactcctgg
gaggaggcctccaccctccaagtcaactcgtcccaggccgtcctggagccagagcacctc
attcccagcagcacgtatgtggcccgagtacgcacccatctggcccccagctccgggctc
tcggggcggcccagcccgtggagcccggaggtcctctggcactcgcagacaggggacaag
gcccagccccagaacctccagtgtttcttcgacggggcctccgtgctcagctgctcctgg
gaagtgaggtctgaggtggccagctcagtgtccttcgccctcttctacaagaccagcccc
aatgcaggggaggaagagtgctccccagtgctgaaggaggagctccccggcctctacgtc
cggcatcggtgccagattccagtgcccgaccccgggaaccacagccagtacactgtctcc
gttcggccgaaggaggaggagaagtttataaagagctcggacaacatccagatggctcag
ccagccgtcaacgtgaccaaaagcagagacggctataccctgcactggacggcaaaggag
atgttctacaaacacataggtcacaccttccaggtccagtacaagacggatgcagcctcg
tgggaggagagcaagacggaaaccctccagaatgcccacagcatgtcgctgccaccgttg
gaaccctctaccaggtaccgggcaagagtgagggtcgagcccacccccagcggctaccgt
ggcatctggagcgactggagtgaggagtgcttctgggacaccgagtgggtgctacccacg
tgggtcctggtgctcatcctggtcttcaccactctggcgttgctccctgccctgcgcttc
tgcggcatgtacgggtacaggctgaaccggaagtgggaggagaaaatccccaaccccagc
aagagccacctgttccagaacggcagtgcggggctccagctcccaggcagcatgtcggcg
ctcgtcagcatgagccccccgcacaaggggccgcaaggcagcctcttccctgagctggac
ggggtgttccctgtgaactacaggcacagcgaggtgtcacctctcaccatggaggacccg
aaagatgcccgtgaatcaccatgcgagcctgacgcaactccagcctcctcggacctattg
gcggagcaggcctgcggcccccagccaggaccgtcagcccccgcaagcaggcctgagagc
cagggttctggcttcgacttcaatggcccctacctggggctcccccacagccactccctg
cctgatgtgctgggccagccggcgcccccgcaggcaggcgtgagccagaagccacagcct
cccggggccctggagtacctgtgtctgcccgcgggggggcgggtgcagctggtcccgctg
gcccaggtgatggcacagggccaggccaaggacttggacaggacccctggcccagaggct
gaggggagcccctccctggagtcaggcgcgggcctcgccccttctgcacccgggctgatg
gtaggcggtcaaggcgcaaagaacagccccagcgcaaaggacgtggtcctcacagctcgg
ccccctggctccaggggccctgagggtggtttcctggcctctggctatgtcaccactaca
gacctggcactccccttgcccacggagctgccatctgtctccacagttcaccctgggcac
ctgccctcagaccagaaccagagcctgagtcttggaggagctggcgggccccatgcagcc
ccagcccccgggaaaccagaaatcgagggctatgtggatgtccctccaaccccaggccag
tcttccaagcccgctctgggcgatcctgcccctcctacagccagtagctccatgctcagc
ccggcggagcccagagcagagggggcacccccctccccccaccctgaggggctcctggtc
ctgcagcaggtgggtgactactgtttcctccctggcctgggctctggctctctctcaccc
cagacaaagccctcttccccaggaccctgtcctgagattggggaccacgaccaggtgttc
caggccaagaaggccctgggccaggctgttccccagatgccagccatccggcacttcaaa
gccctccagcagcaggactacctgtcgctgcccccctgggatgtgggcaggcctgaggag
gtgcgctga

KEGG   Ursus arctos horribilis: 113256701
Entry
113256701         CDS       T05909                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1 isoform X1
  KO
K05063  interleukin 12 receptor beta-1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113256701 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256701 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113256701 (IL12RB1)
   04659 Th17 cell differentiation
    113256701 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256701 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113256701 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113256701 (IL12RB1)
   04090 CD molecules [BR:uah04090]
    113256701 (IL12RB1)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113256701 (IL12RB1)
CD molecules [BR:uah04090]
 Proteins
  113256701 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 113256701
NCBI-ProteinID: XP_026356292
UniProt: A0A3Q7X100
LinkDB
Position
Unknown
AA seq 767 aa
MHARRMGGWVEDCRCEWMGGRVGGSIDGRADGWMDGPLASPQPEPLPHAVKDWECHYLLI
VFAAEACSTGQCCFQDLPYPDADSGSASGPRDLNCYRIVSAGYECSWQYEGPTAGVSHFL
RCCLRNGPCCYFAAGSATSLQFSDQDGVAVLQTVRLWVESRAENRTHRSPEIELSLHSTV
KYDPPQAGDITVSGSAGKVLLKWETPARQDGAEVQFRYRTPGSLWKLGDCRHREDPGFEA
CLCPWQMDAAQEFQLRRRRLRQEAPGNPWSNWSSPVCIPPEHSPQSTLTFSVEALRPDGK
RQVTLHGQLPRLELPEGCLGSNSGGEVTYRARLHMLSCTCKTKSTATFQLRKPLDLSGAA
YDLAIISRNRFGHGPSQTWHIPAQTHTHTEPGALNISVGANGTTMHWPAQARAKAYCIEW
QSQSQHGNLTNCTLTMPQDQDPTGMATHSWSRESGAMEQKVCYHITIFASPRPEKPTLWS
TILSTYHFGGNASGAGSPQHVLVKKLGQDSVSVDWTPSALSACPGVLKEYVVRCRDEEGN
VVSELPVKPTETQVTLGGLRAGTAYIVQVRADTATLRGAWSQPQQFSTEVQVSRLFDLSI
LLASLGSFASILLLGVLGYLGLNRAARHLCPPLPTPCASTVVEFPSSQGKQAWQWTSPAD
FPEEVSPKEALVVNMSWEKGEGTDLDTPVHLRKTQLLRGAPELALDAELPLEDRRQVQGH
PEARALGLGRQDGLEGNPAQVTGLLLPLGDLIQTPICSGPLQMGLEA
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgcatgcacgcaggatgggtggatgggtggaagactgcaggtgtgaatggatgggagga
cgggtgggtgggtccatagatgggagagcggatgggtggatggatggtcccttggccagc
ccccagcctgaacccctcccccatgcagtgaaagactgggaatgtcattatctcctcatt
gtctttgcagctgaagcctgcagtaccggtcagtgctgttttcaggacctgccatatccg
gatgcagactcaggctcggcttcaggccccagggacctgaactgctaccggatagtcagc
gctggttatgaatgctcctggcagtatgagggccccacggctggggtcagccacttcctg
aggtgctgcctccggaatgggccctgctgctactttgccgcgggctcggccaccagcctg
cagttctctgaccaggacggcgtagccgtgctccagactgtcaggctctgggtggaatct
cgagccgagaaccggacgcacaggtcgcctgagatcgaactgagccttcatagcacagtt
aaatacgaccctccgcaagctggagacatcaccgtgtcggggtccgcagggaaggtgctc
ttgaagtgggagaccccagcccgccaggatggcgccgaggtacagttccgctaccggaca
cctggcagcctgtggaagttgggcgactgcagacatcgagaggaccctggcttcgaggcc
tgcctctgcccctggcagatggacgcagcccaggaattccagctacgccggaggcgactc
cggcaggaagccccaggaaacccctggagcaactggagcagccccgtgtgtatcccccct
gaacattctccacagtccaccttgacgttctcagtggaggcgctccggccagatgggaag
aggcaggtgaccctgcacgggcagctgccccggctcgagcttccagaaggctgcctcggg
tccaactctggcggggaggtgacctaccgcgcccgcctgcacatgctatcctgcacatgt
aagaccaagtccaccgcgacctttcagctgaggaaaccgctcgacctctctggcgcagcc
tatgacctggccatcatctcccggaaccgcttcggccacggccccagccagacgtggcac
attcctgcccaaacccacacccacacagaaccaggggctctgaatatcagtgtcggagcc
aacgggaccaccatgcactggccagcccaggccagagccaaggcatattgcatcgagtgg
cagtcccagagccagcatgggaaccttaccaactgcaccctgactatgccccaggatcag
gaccctactggaatggcaacccacagctggagcagagaatctggggcaatggagcagaag
gtgtgttaccacatcacgatctttgcctctccacgcccagagaagcccactttgtggtcc
acgatcttgtccacctaccactttgggggcaatgcctcgggggccggaagcccacagcac
gtgttggtgaagaagcttggccaggactccgtgtctgtggactggacgccatccgcgctg
agcgcctgccccggggtcctgaaggagtacgtcgtgcgctgccgggatgaggagggcaac
gtcgtgtccgagctgcccgtgaagcccacggagactcaggtcacgcttggtggccttcgg
gctggcacagcctacatcgtgcaggttcgagcagacacggcgacgctgcggggcgcctgg
agccagccccagcagttcagcaccgaagtccaggtttcccggttgttcgatttgtccata
ctccttgcgtctctggggagcttcgccagcatccttctcctgggtgtccttgggtacctc
ggcctgaacagggctgcacggcacctgtgtccgcccctgcccacaccctgtgccagcact
gtggtcgagttccctagcagccaggggaagcaggcttggcaatggacaagcccggcagac
ttcccggaggaggtgtccccgaaagaggccttggtggtgaacatgtcctgggaaaaaggt
gagggaactgacctggacacacctgtgcatctcaggaagacacagctacttcggggtgct
cctgagctggccttggatgcagagctacccttggaggacaggagacaggtgcaaggccac
cctgaggctcgggctctggggctgggcaggcaggatggtctggagggcaaccctgcccag
gtgactggactcttgctgcccttgggggacctaatacagacccccatatgcagtggccct
ttgcaaatgggcctggaggcctaa

KEGG   Ursus arctos horribilis: 113257099
Entry
113257099         CDS       T05909                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha isoform X1
  KO
K05067  interleukin 5 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113257099 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113257099 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113257099 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113257099 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113257099 (IL5RA)
   04090 CD molecules [BR:uah04090]
    113257099 (IL5RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL3 receptor family
   113257099 (IL5RA)
CD molecules [BR:uah04090]
 Proteins
  113257099 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac fn3 EpoR_lig-bind LIFR_D2 DICT
Other DBs
NCBI-GeneID: 113257099
NCBI-ProteinID: XP_026357038
UniProt: A0A3Q7W6T4
LinkDB
Position
Unknown
AA seq 417 aa
MAPALFILLWAAVIPRADLLPDKKSLLLPPTNFTVQVIGLAQVLLRWEPNPDQEPKNVEL
GYHVRINGPQEEDYETRNTESKRVTVLHQGFSASVQTIPWNGHSLLASDWVSAELKAPPG
SPGTSVVNLTCTTNTTLNNYDPLRPFQVSLYCTWLVGKDAPEDTHYSLYYRYGSSTEECQ
EYRKDTLKRNIACWFPRTFISSRGSDWLAVHANGSSKRATIKPFDQLFALHAIDRINPPL
NVTAEIEGTCLSIQWEKPISAFPVHCFEYEVKIYNTRKNYFQTEKMTTNTFISIIDDISK
YSIQVRAAVSSVCRQMGFWSEWSQPIYVGHDDQKLSTEWFLIVLMATICFLVLIFTLICK
TGHLWTRLFPPVPAPKNSIKDFFVIVSPEKTVSSETEIEVISYVEEPGLETLEDSVF
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcgcctgcattattcattctgctatgggctgcggtgataccaagagcagacttactt
cccgataaaaaatctttgcttctcccccctaccaacttcaccgtccaagttattggtcta
gcccaagttcttttacgctgggaaccaaatcctgatcaagagccaaagaatgtcgagcta
ggctatcacgtgagaataaatggtccgcaagaagaagattatgaaaccagaaacactgaa
agcaaacgcgtaaccgttcttcatcaaggcttttcagcaagtgtgcagaccatcccatgg
aatggccactccctcctggcaagcgactgggtttctgctgagcttaaagccccaccgggg
tctcctggaacctcggttgtgaatttaacatgtactacgaacaccacattaaataactat
gatcccttaaggccattccaagtttctctttactgtacctggctggttggcaaggatgcc
cctgaggatacgcactattccctctactataggtatggctcctcgaccgaagaatgccag
gagtataggaaagacacactgaagagaaatattgcatgctggtttccgaggacttttatc
agtagcagagggagtgactggctggcagtgcatgctaatggctccagcaagcgtgctaca
atcaagccttttgatcagctatttgctctgcatgcaattgatcgaattaatcctccactg
aatgtcacagcagagattgaaggaacctgtctttcgattcagtgggagaaacccatttct
gcctttccagttcactgctttgaatatgaagtgaaaatttacaacacaaggaaaaattat
tttcagacagaaaaaatgacaacgaatacattcatctcgataattgatgatatttctaaa
tattccattcaagtgagagcagcagtgagttctgtgtgcagacagatggggttttggagt
gagtggagccaacctatatatgtgggacatgatgatcagaagctctccacagaatggttt
ctaattgtgcttatggcaaccatctgcttcctcgtgttaattttcaccctcatctgtaaa
acaggtcacttatggaccaggttgtttccaccggttccggcaccaaaaaacagtattaag
gatttctttgtaatcgtcagccctgagaaaacggtttccagtgaaacagaaattgaagtc
ataagttatgtggaagagcctggacttgagaccctggaagattccgtgttttga

KEGG   Ursus arctos horribilis: 113257444
Entry
113257444         CDS       T05909                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04020  Calcium signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04072  Phospholipase D signaling pathway
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04520  Adherens junction
uah04540  Gap junction
uah04630  Jak-STAT signaling pathway
uah04810  Regulation of actin cytoskeleton
uah04912  GnRH signaling pathway
uah04915  Estrogen signaling pathway
uah04921  Oxytocin signaling pathway
uah04926  Relaxin signaling pathway
uah04928  Parathyroid hormone synthesis, secretion and action
uah04934  Cushing syndrome
uah05160  Hepatitis C
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05219  Bladder cancer
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113257444 (EGFR)
   04015 Rap1 signaling pathway
    113257444 (EGFR)
   04010 MAPK signaling pathway
    113257444 (EGFR)
   04012 ErbB signaling pathway
    113257444 (EGFR)
   04630 Jak-STAT signaling pathway
    113257444 (EGFR)
   04066 HIF-1 signaling pathway
    113257444 (EGFR)
   04068 FoxO signaling pathway
    113257444 (EGFR)
   04020 Calcium signaling pathway
    113257444 (EGFR)
   04072 Phospholipase D signaling pathway
    113257444 (EGFR)
   04151 PI3K-Akt signaling pathway
    113257444 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113257444 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113257444 (EGFR)
   04520 Adherens junction
    113257444 (EGFR)
   04540 Gap junction
    113257444 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113257444 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113257444 (EGFR)
   04915 Estrogen signaling pathway
    113257444 (EGFR)
   04921 Oxytocin signaling pathway
    113257444 (EGFR)
   04926 Relaxin signaling pathway
    113257444 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    113257444 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113257444 (EGFR)
   05206 MicroRNAs in cancer
    113257444 (EGFR)
   05205 Proteoglycans in cancer
    113257444 (EGFR)
   05230 Central carbon metabolism in cancer
    113257444 (EGFR)
   05231 Choline metabolism in cancer
    113257444 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113257444 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113257444 (EGFR)
   05212 Pancreatic cancer
    113257444 (EGFR)
   05225 Hepatocellular carcinoma
    113257444 (EGFR)
   05226 Gastric cancer
    113257444 (EGFR)
   05214 Glioma
    113257444 (EGFR)
   05218 Melanoma
    113257444 (EGFR)
   05219 Bladder cancer
    113257444 (EGFR)
   05215 Prostate cancer
    113257444 (EGFR)
   05213 Endometrial cancer
    113257444 (EGFR)
   05224 Breast cancer
    113257444 (EGFR)
   05223 Non-small cell lung cancer
    113257444 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113257444 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    113257444 (EGFR)
   05163 Human cytomegalovirus infection
    113257444 (EGFR)
   05165 Human papillomavirus infection
    113257444 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113257444 (EGFR)
   01522 Endocrine resistance
    113257444 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113257444 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113257444 (EGFR)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113257444 (EGFR)
Protein kinases [BR:uah01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   113257444 (EGFR)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   113257444 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   113257444 (EGFR)
  Exosomal proteins of bladder cancer cells
   113257444 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Borrelia_P83 Kdo
Other DBs
NCBI-GeneID: 113257444
NCBI-ProteinID: XP_026357385
UniProt: A0A3Q7VXF8
LinkDB
Position
Unknown
AA seq 1207 aa
MRPSGTVGAALLALLAAHFQASPALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQKNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQVIRGNVLYENTHALS
VLSNYGTNKTGLRELPLRNLHEILQGAVRFSNNPVLCSVETIQWRDIVDGDFVSNMSMDF
QNQAGSCQKCDPGCPNGSCWGPGKENCQKLTKVICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTRTLPLDPKELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNQKLCYANTINWKKL
FGTSSQKTKIINNKDEKGCKAIGHVCHPLCSSEGCWGPEPKDCVSCRNVSRGKECVEKCN
VLQGEPREFVENSECIQCHPECLPQAMNVTCTGRGPDSCVKCAHYIDGPHCVKTCPAGIM
GENNTLVWKFADANRVCHLCHSNCTYGCAGPGLEGCATNGPKIPSIATGIVGGLLLVVVV
ALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQ
QGFFHSPSTSRTPLLSSLSATSNNSAVACIDRNGSCPLKEDSLLQRYSSDPTGTLTEDNI
DDTFLPAPEYINQSVPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNPHSNAVGNPEYLNTH
PTCVSSVLDGPGLWAQKGNHQISLDNPDYQQDFFPKEAKSNGIFKGPAAENADYLRVAPP
SSEFIGA
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggacggtgggagccgcgctcctggcactgctggctgcgcacttccag
gcgagtccggcgctggaggaaaagaaagtttgccagggcacaagtaaccggctcacccaa
ttgggcactttcgaagaccactttctgagccttcagaggatgttcaacaactgtgaggtg
gtcctcgggaatttggaaataacctacatgcaaaagaattatgacctttccttcttgaag
accatccaggaagtcgccggctatgtactcattgccctcaacacagtggagaagattcct
ttggaaaaccttcaggtcatccgaggaaacgtgctctatgagaacacccatgccttatct
gtcttatccaactacggcacaaataaaaccggactgcgggaacttcccctgagaaactta
cacgaaatcctacaaggcgctgtgcgcttcagcaacaaccctgtgctctgcagcgtggaa
accatccagtggcgggatatcgttgacggcgactttgtgagcaatatgtcgatggacttc
cagaaccaagcgggcagttgccaaaagtgtgatccaggctgtcccaatggaagctgttgg
ggtccgggaaaggagaattgccagaaattgaccaaagtcatctgtgcccagcagtgctca
gggcgctgccgcggccggtcccccagcgactgctgccacaaccagtgtgccgccggctgc
acggggccccgcgagagcgactgcctggtctgccgcaagttccgggacgaagccacgtgc
aaggacacctgcccgcccctcatgctgtacaaccccaccacctaccagatggatgtcaac
cccgaggggaagtacagttttggtgccacctgcgtgaagaaatgcccccgtaactacgtg
gtgacagaccacggttcgtgtgtccgtgcctgcagctccgacagctacgaggtggaggaa
gacggcgtccgcaaatgtaaaaagtgtgaggggccttgccgcaaagtttgtaatggaata
ggaattggtgaatttaaagacacactttccattaatgctacaaatattaaacacttcaaa
aattgcacctcaatcagtggagatcttcatatcctgccggtagcatttagaggtgactcc
ttcacacgtactctacctctggatccaaaggaactggatattctaaaaactgtaaaggaa
ataacagggtttttgctgattcaggcctggcccgagaacaggactgacctccatgctttc
gagaacctagaaatcatacgtggaagaacaaagcaacatggtcagttttctcttgcggtc
gtcggcctggacataacatccttgggattacgctccctcaaggagataagtgatggagac
gtgatcatctcaggaaaccaaaaattgtgttatgcaaatacaataaactggaaaaaacta
tttgggacttcaagtcagaaaaccaaaatcataaacaacaaagatgaaaaaggctgcaag
gccataggccacgtctgccatccattatgttcatccgagggctgctggggcccagagccg
aaagactgcgtgtcctgccgcaacgtcagccggggcaaggaatgtgtggagaagtgcaat
gttctgcagggggagccaagggagtttgtggagaattccgagtgcatacagtgccatccg
gaatgcctgccccaagccatgaatgtaacctgcacaggacggggaccggacagctgcgtc
aagtgtgctcactacatcgatggccctcactgcgtcaagacctgcccggctggcatcatg
ggcgagaacaacaccctggtctggaagttcgcggatgccaatcgcgtgtgccacctgtgc
cattccaactgtacctacggctgtgctgggccaggtcttgaaggctgtgcgacaaacggg
cccaagatcccatccattgccaccgggatcgtgggcggcctcctcctggtggtggtggtg
gcccttggggtgggcctgttcttgcgccggcggcacatcgtccggaagcgcacgcttcgt
agactgctgcaggaaagagagcttgttgagcctcttacacccagcggagaagctcccaac
caagctctcttgaggatcttaaaggaaacagaattcaaaaagatcaaggtgctgggctct
ggagcattcggcacggtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
cccgtggccatcaaggaattaagagaagccacatctccaaaagccaacaaggaaattctt
gatgaagcctacgtgatggccagtgtggacaatcctcacgtgtgccgtctcctgggcatc
tgcctgacctccacggtccagctcatcacacagctcatgcccttcggctgcctcctggac
tatgtccgcgagcacaaggacaacattggctcccagtacctgctgaactggtgtgtgcag
attgccaagggcatgaactacctggaagaccggcgcttggtgcaccgtgacctggcagcc
agaaatgtcctggtgaagaccccacagcacgtcaagatcacagattttgggctggccaaa
ctgcttggtgctgaggagaaagaataccacgcagaaggaggcaaagtacctatcaagtgg
atggccttggagtcaattttacaccgaatttatacccaccaaagtgatgtgtggagctat
ggagtcactgtttgggagttgatgacctttgggtccaagccttatgacggtatccccgca
agtgagatctcaaccatcctggagaaaggagagcgcctcccacagccacccatatgcacc
atcgatgtctacatgatcatggtcaagtgctggatgatagatgcggacagtcgcccaaaa
ttccgtgaattgatcattgagttctccaaaatggcccgcgacccccagcgctaccttgtc
atccagggagacgagaggatgcatttgccaagccctacagactccaacttttaccgcgcc
ctgatggacgaagaggacatggaggacgtcgtggacgccgacgagtacctcatcccccag
cagggcttcttccacagtccctccacatcccggacccccctcctgagttccctgagtgcc
accagcaacaattccgccgtggcttgcattgacagaaatgggagctgtcccctcaaagaa
gacagcctcctgcaacggtacagctcggaccccactggcaccttgaccgaggacaacata
gatgacaccttcctcccagcacctgaatacataaaccagtccgttcccaaaaggcctgcg
ggttctgtccagaaccccgtctatcacaatcagcctctaaatccagctcctggcagagac
cctcactaccagaatccccacagcaacgcagtgggcaaccccgagtatctcaacacacac
cctacctgcgtcagcagtgtgctcgacggccccggcctctgggcccagaaaggcaaccac
cagatcagcctggacaacccggactaccagcaggacttctttcccaaggaagccaagtca
aacggcatctttaagggccccgccgctgaaaatgcagactacctgagggtagcgccccca
agcagtgagtttattggagcatga

KEGG   Ursus arctos horribilis: 113259362
Entry
113259362         CDS       T05909                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113259362 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113259362 (IL22RA2)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL10/28 receptor family
   113259362 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 113259362
NCBI-ProteinID: XP_026360462
UniProt: A0A3Q7XD57
LinkDB
Position
Unknown
AA seq 231 aa
MTPKHCFLGFLISFFLTGVVETQSAPESLKPQRVHFQSRNFHNILHWQPGRACTSNSSVY
FVQYKIYGQRQWKNKEDCWGILEFFCDLTNETSEIQEPYYGRVRTTSAGIHSGWTMTQRF
TPWWETKIDPPVLNITQVNGSLWVILHAPSLPYRDQKGKNVSIENYYELVYRVFIITNSL
EKEQKVYEGAGRVVKIGTLAPHAGYCVVAEMYQPVLDRRSQRSKEQCVELP
NT seq 696 nt   +upstreamnt  +downstreamnt
atgacgcctaaacattgctttctaggcttcctcatcagtttcttcctgactggtgtagta
gaaactcagtcagcccctgagtctctgaagcctcagagagtacatttccagtctcggaat
ttccacaatattctgcactggcagcctgggagagcttgcaccagcaacagcagtgtctat
tttgtgcagtacaaaatatatggacagagacaatggaaaaataaagaggactgttggggt
attctagaattcttttgcgaccttaccaacgaaacatcagaaatacaggaaccttactat
gggcgggtgaggaccacctcggctgggatccactctggctggaccatgacacagcgcttc
actccctggtgggaaacaaaaatagatcctccagtcctgaatataacccaagttaatgga
tctttgtgggtgattctccatgctccaagtttaccatacagagaccaaaaaggaaaaaat
gtatcaatagaaaattactatgagctagtataccgagtctttataattactaattcactg
gaaaaggagcaaaaggtatatgaaggagctggcagagttgtcaaaattggaactctggca
cctcatgcgggttactgtgtggtggctgaaatgtaccagcccgtgctagaccgaagaagt
cagagaagtaaagagcaatgtgtggaacttccttga

KEGG   Ursus arctos horribilis: 113259484
Entry
113259484         CDS       T05909                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin-20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113259484 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113259484 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113259484 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113259484 (IL20RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL10/28 receptor family
   113259484 (IL20RA)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 113259484
NCBI-ProteinID: XP_026360669
UniProt: A0A3Q7X245
LinkDB
Position
Unknown
AA seq 502 aa
MRNILQWSPPEGLQGAEVTYTVQYFIYGQKKWLNKSECRNINRTCCDLSLETSDYEHQYY
AKVKAIWERNCSKWAETGRFYPFLETQIGPPRVALTTDEKSISIVLTAPEKWKRNPEDSS
ISMQQIYSNLKYNVSVYNTKSNRTWSQYVTNHTLVLSWLEPDTLYCVRVESFVPGPPRLA
QPSDKQCVRTLKDQASALKVKIIFWYVLPISVTVFLFSVMGYSMYRYIHVGKEKHPANLI
LIYGNEFDKRFFVPAEKIVLNFITLNILEDPNTSHKDVSVRGKSSEVWDLNEPLENHEPP
QEDMEVKHVGYAFHLMDTFCDSEESANGTSLTQQESLGRTTPTDKAVIEYEYAVRTADIC
AGPGDQELNQQEDVSLQGQFLEQRAALADLGSQTPRYSYAPQLRDLDQLLQEHVDTEEEP
DEEASTTLVDWDPRTGRLCIPSFSSFEHDSDGCEQPAYKELTDEGLLSRLYEDQAPEEPS
EENEAYLMRFMEEWGLYVQMQD
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgaggaatattctccagtggagtccaccagagggcctacaaggagctgaagttacttat
actgtgcagtatttcatatatgggcaaaagaagtggctgaataaatccgaatgcagaaat
atcaataggacctgctgtgatctctctctggaaacttctgattacgaacatcaatattat
gctaaagttaaggccatttgggaaaggaattgctccaaatgggcagaaactggacgattc
tatccattcttagaaacacaaattggcccaccaagggttgcattgactacagatgagaaa
tccatttctattgttctgacggctccagagaagtggaagagaaatccagaagacagttct
atttccatgcaacagatatactctaatctgaagtataatgtgtccgtatataatactaaa
tctaacagaacgtggtcccagtatgtgaccaaccacacactggtgctgagctggctggag
ccagacactctgtactgcgtgcgcgtggagtccttcgtcccagggcctcctcgccttgct
cagccttctgacaagcagtgtgtccgtactttgaaagaccaagcatcagcattgaaggtt
aaaatcatcttctggtatgttttgcccatatctgttaccgtgtttcttttttctgtgatg
ggctactccatgtacagatatatccatgttggcaaagagaaacacccagcaaatttgatt
ttgatttatggaaatgagtttgacaaaagattctttgtacctgctgaaaaaattgtgctg
aatttcatcaccctcaatattttggaggatcctaacacttctcacaaggatgtaagcgta
aggggaaaaagcagcgaggtatgggacctgaacgagcccctcgagaaccacgagccacct
caggaggacatggaggtgaaacacgtagggtatgctttccatttgatggacactttctgt
gactctgaggaaagcgccaacggtacatccctaacccagcaagagtcactgggcagaaca
acccccacagacaaagctgtcattgaatacgaatatgctgtaagaactgctgacatttgt
gcagggcctggagatcaagagctcaatcagcaggaggacgtgtccctccaaggacaattc
cttgagcaacgggcagctttggcagacctgggctcccaaacaccacggtattcgtatgcc
cctcagctgcgagacttggaccagctgctgcaggagcacgtggacacggaagaggagcca
gatgaagaggcatcgaccacactggtcgattgggaccctcggactggcaggctgtgcata
ccgtcattctctagctttgaacatgactccgacggatgtgagcagcctgcgtacaaggag
ctcacggacgagggcctcttgtctagactctatgaggaccaggctccagaggagccatcg
gaagaaaatgaagcctatctcatgagatttatggaggaatggggattgtatgtgcaaatg
caggactaa

KEGG   Ursus arctos horribilis: 113259485
Entry
113259485         CDS       T05909                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04066  HIF-1 signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05164  Influenza A
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113259485 (IFNGR1)
   04066 HIF-1 signaling pathway
    113259485 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113259485 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113259485 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113259485 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    113259485 (IFNGR1)
   04659 Th17 cell differentiation
    113259485 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113259485 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113259485 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113259485 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113259485 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113259485 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    113259485 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    113259485 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113259485 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113259485 (IFNGR1)
   05140 Leishmaniasis
    113259485 (IFNGR1)
   05142 Chagas disease (American trypanosomiasis)
    113259485 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113259485 (IFNGR1)
   04090 CD molecules [BR:uah04090]
    113259485 (IFNGR1)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IFN receptor family
   113259485 (IFNGR1)
CD molecules [BR:uah04090]
 Proteins
  113259485 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 113259485
NCBI-ProteinID: XP_026360671
UniProt: A0A3Q7VHY3
LinkDB
Position
Unknown
AA seq 509 aa
MPGLPLERWSPGPEVTRRSGCGLNARILSRPHPESALSGMALQLLLVLVLQAGSWAEMSP
ADLELSSVPVPTNIRFEAHNFNTVLRWDYPTMPQTPVFTVQVKNYGEAIWIDACNTSHHN
CDIFSVINDPSLSLWARIKARLGQKESAYVESKEFILCKQGNIGPPAVGIRKMENQIIID
IFHPLTNISGREPVPIYDENNCHIFIYTVNLRINGSETIYKTTVENEDDCNETQCHLVIP
LSSLNSDYCISVDGVSKDWPVTTEMSKELCITTSDDRHMEDSVWIPIVAALLFLVLMLVF
VFCYTKKMNPCKRESIMLPKSLLSVVKNASSETKSESKCISPITYQPIVPENEKMVWEEQ
LSPATVAGTPTEDNLGKMEHREDVSSEIEVVTIEENTSDMAPGSPPTPGMRENSVHSNSN
QSEPCVVAFNSYHSRNGSDSGVVESDGFLSDSEFPPNNKTEQKPEVQECVVLRNTITSFG
YDKPHVLVELPVDEGGKESLIGYRLTADS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgcccggcctccccttggagcgctggtcccctggtccggaagtgacgcgacgctcgggc
tgcgggctcaacgcccgcattctctcaaggccgcaccccgagtcagccctgagcggcatg
gctctgcaacttctgctcgtcctcgtcttgcaggccgggagctgggctgagatgagcccc
gcggatctggagctgtcttcggtgcctgtaccaaccaatattagatttgaggcccataat
tttaatactgtcctacgctgggactacccaaccatgccacagacccctgtttttactgta
caggtaaagaactatggggaagcaatatggattgatgcctgcaatacctctcatcataat
tgtgatatcttttccgtaattaatgatccgtcactttctctctgggccagaattaaagct
aggcttggacaaaaagaatcagcctatgtagagtccaaagaatttattttatgtaaacaa
gggaacattggaccacctgcagtaggtatcagaaagatggaaaaccaaatcatcattgac
atatttcaccctttaactaatataagtggaagagagccagtacccatatatgacgaaaat
aattgtcacatattcatatacacggtgaatttgagaataaatggaagtgagaccatctat
aaaacgacagtagagaatgaagatgattgcaatgagacccagtgccaccttgttatcccg
ctgtcctccctgaactctgactactgtatttcagtagatggcgtctcaaaagattggccc
gttacgaccgagatgtccaaagaactttgtattaccacttctgatgatcgccacatggaa
gattctgtttggattccgattgttgctgctctcctgtttctagtgcttatgctggtattt
gtattttgttacactaagaagatgaatccatgtaagagagaaagcatcatgttacccaag
tccttgctgtctgtggtaaaaaatgcctcctcagagacaaaatcggaatccaagtgtata
tcacccatcacctaccaaccgattgtcccagaaaatgagaagatggtctgggaagagcag
ttgtctccagcaacagttgcagggacacccactgaagacaacctaggaaaaatggaacac
cgagaagacgtttccagtgaaatagaagtggtgaccattgaagaaaatacttctgacatg
gctcctggtagccctccgaccccaggaatgagagagaattctgtccattcaaatagtaac
cagtctgaaccctgtgtcgtcgccttcaactcctatcactccagaaatggttctgacagt
ggcgttgtggaatctgatggcttcttatctgactcagaatttcccccaaataacaaaact
gaacagaagcctgaagtccaggagtgcgtagtgctgagaaacaccatcacctcctttggt
tacgacaagccgcacgtgttagtggagctgcctgtggatgaaggtggcaaggaatccttg
attggttatagactgacggcagattcctga

KEGG   Ursus arctos horribilis: 113260009
Entry
113260009         CDS       T05909                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04630  Jak-STAT signaling pathway
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260009 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260009 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113260009 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260009 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113260009 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113260009 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113260009 (IL10RA)
   04090 CD molecules [BR:uah04090]
    113260009 (IL10RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL10/28 receptor family
   113260009 (IL10RA)
CD molecules [BR:uah04090]
 Proteins
  113260009 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 113260009
NCBI-ProteinID: XP_026361450
UniProt: A0A3Q7W9A4
LinkDB
Position
Unknown
AA seq 575 aa
MLPRLVVLLVALRSVSLGSCAHELPSPPSVWFEAEFFSHVLRWTPIPKPSNSTYYEVELL
RYGIEPWKSIPSCSQTHVSFCDLTMVTLDLYHNNGYRAKVRTVDGNQYSNWTFTNTRFSV
DEVTLTVGSVKLEVHNGIILGKIQPPRPKLAPLGDTYESIFQHFREYEIQIRKVPGNYTF
TKEKVKHENFSLSPPGELGQFCVKVKPSVSSRMNKGVWSKEECIVLTRQYFTATNLSIFF
IFVLLLCGALAYCLALHLYVRRRKKLPSVLVFEKPQPSSFVSQLPCPEPQDAIYPLDEEA
FPKVSPELKNSELHGSTDSGFGSAKPSLQNEEPQFLLPAPHPQAGATMGKGAPPELDSSC
SGGSSTDSGICLQEPRLSPSTGPSWEQQVGNSSQDQDDSGIGLVQNSEGQPGDGQGGSAL
GHVNPPRPEAPGEEDPDSVAFRGYLKQTRCTEEKAAKTGCLEEESSSTDSLGPKFRTCLD
AEARWPPPVLAKGYLKQDPGMTVTPSGTSTGQWDQPTEEWSLLGLTSCGDLGESDWSLAH
DLAPLDCLAAPGSLLGSFDSNLVTLPLISSLHSNE
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgctgccgcgcctggtagtgctgctggtggcgctccgcagcgtgagcctcggttcctgc
gcgcacgaactgcccagccctccatctgtgtggtttgaagcagaatttttctcccacgtc
ctccgctggactcccatcccaaaaccatcaaacagcacctactatgaagtagagcttctg
aggtatgggatagaaccctggaagtccatccccagctgcagccagacccacgtgtcgttc
tgtgatctcactatggtgaccctggacctgtaccacaacaatggctaccgagccaaagtc
cgcacggtggatggaaaccagtactccaactggaccttcaccaacacccgcttctctgtg
gatgaagtgactctgacggttggcagcgtgaagctagaggtgcacaatggcatcatcctc
gggaagatccagccccccaggcccaagctagcccctctgggcgacacttacgaaagcatc
ttccaacacttccgcgagtatgagattcagatccgcaaggtgccagggaactatacgttc
acaaaggagaaggtgaagcatgaaaacttcagcctctcaccccctggagaactgggacag
ttctgtgtcaaggtgaagccgtctgtgagctcccgaatgaacaagggggtatggtccaag
gaggaatgcatcgtgctcacccggcagtatttcaccgcgaccaacctcagcatcttcttc
atcttcgtcctgctgctgtgcggagccctggcctactgcctggccctccacctgtacgtg
aggcgccgcaagaagctgccttccgtcctggtcttcgagaagcctcagccctccagtttt
gtcagccagcttccctgccccgagccccaggatgccatctaccccctggatgaggaggcc
ttccccaaagtgtccccagagctgaagaactcggaactacacggcagcacggacagtggc
tttggcagtgccaaaccatccctgcagaatgaagagccccagttcctcctccctgccccc
cacccacaggctggggcgaccatgggcaagggggcgcccccggagctggacagcagctgc
agtggtggcagcagcacagacagcgggatctgcttgcaggagcccaggctgagtcccagc
actggccccagctgggagcagcaggtggggaacagcagccaggaccaggacgacagtggc
attggcctcgtccagaactctgaagggcagcctggggacgggcagggtggctccgccttg
ggccatgtcaatcctcccaggcctgaggcgcctggggaagaagacccagactcagtggca
ttccggggctacctgaagcagaccagatgcacagaggagaaagcagccaagacaggctgc
ctggaggaagagtcctcctcgacagatagccttggccccaagttcaggacatgcctagat
gccgaggcacgctggcctccaccagtgctggccaagggctatttgaaacaggatccagga
atgactgtcactccctcaggtacctcaactggacagtgggaccagccaacggaggaatgg
tcgctcctgggcttgaccagctgtggtgacctaggagaatctgactggagcttggcccat
gatcttgcccctctggactgtttggcagccccaggcagtctcctgggcagctttgactca
aacctggtcaccctgccactaatctccagcctccactcgaatgagtga

KEGG   Ursus arctos horribilis: 113260499
Entry
113260499         CDS       T05909                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260499 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260499 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113260499 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113260499 (IL11RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113260499 (IL11RA)
SSDB
Motif
Pfam: Ig_3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 113260499
NCBI-ProteinID: XP_026362111
UniProt: A0A3Q7VM63
LinkDB
Position
Unknown
AA seq 577 aa
MSGGVENPCPTEPSLSGVRGTFSFSSHLPNGPGATELKALVLDCCKEEGPETSSPAVPGG
QGCRRGPRNPAPDSVPQQSPQSRTGQEVSGRGGVEVIGSWRLQWAQTPSFFTPVLPLVPG
RSRPLCGGPRAGGSRGRGRGRGRRALAAEAAEDEQQLLRAEQGPAGRGYSPGVCRLPLSP
GLGPPRAPVSWFRDGETRLLQGPDSGLGHELVLARADSTDEGAYICRTLDGALGGVVTLQ
LGYPPARPVVSCQAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGLRMSPSTGPW
PCPQEPPGAARCVVRGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVES
VPGYPRRLHASWTYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLP
HAVRVSARDFLDAGTWSAWSPEAWGTPSTGPVFHRHRLWTILLRSRLPSGPLPKEIPAGG
QPQKQLEEEPQADSPAPPRPSLLPDPRPLDHRDPLEQVAVLASLGIFSFLGLAAGALALG
LWLRLRPDGKDAPQKPRFLAPVIPVDKLPGEIKKSVC
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgtccggcggggttgagaacccttgccccacagagccctccttatctggagtcaggggc
accttcagcttctccagtcacctgcccaatggccccggcgccactgaacttaaggctttg
gttttggactgctgtaaggaggaggggcctgaaacttccagtcctgctgtcccgggaggg
cagggctgtaggcgaggacccaggaatccagctccagactctgtcccccagcagtctcct
cagtcccggacgggacaggaagtgtccggcagaggtggggtggaggtgattggcagttgg
aggctccaatgggcccagaccccctcctttttcaccccggttcttccattggtgcctggg
cggagccgccccctctgcgggggccccagggcgggagggagtagaggccggggcagaggg
cgagggcggagggcgctggcggcggaggccgcagaagatgagcagcagctgctcagggct
gagcagggtcctgctggccgtggctatagccctggtgtctgccgcctccccctgtcccca
ggcctggggccccccagggccccggtgtcctggtttcgggacggggagacaaggctgctc
cagggacctgactctgggctggggcatgaactggtcttggcccgggcagacagcactgat
gaaggcgcctacatctgccggaccctggatggtgcacttgggggcgttgtgaccctacag
ctgggctaccccccagcccgccctgttgtctcctgccaagcagctgactatgagaacttc
tcctgcacttggagccccagtcaggtcagcggtttacccacccgctacctcacctcctac
aggaagaagactgtaccaggagctgatggcctgaggatgagtccatccacagggccctgg
ccatgcccacaggaacccccaggggctgcccgctgtgtagtccgtggggcagagttctgg
agccagtaccgaataaatgtgactgaggtgaaccccctgggggccagcacacgcctgctg
gatgtgagcttgcagagcatcctgcgccctgacccaccccaggggcttcgggtagagtcg
gtacccggctacccccgccgcctgcatgccagctggacgtaccctgcctcctggccccgc
cagccccacttcctgctcaagttccgactgcagtaccgtcccgcgcagcatccagcctgg
tccacggtggagccggcaggattggaggaggtgatcacggacgctgtggctgggctgccc
catgctgtacgggtcagtgcccgggactttctggacgctggcacctggagtgcctggagt
cctgaggcctgggggactccgagcaccggccctgtcttccaccgccaccgcctgtggaca
attctcctcaggtctcgcctcccttcagggcccctgccgaaggagataccagctggggga
cagccacagaagcagctggaggaggagcctcaggcagacagcccagctccccccaggccc
tccctcctgccagacccacggccacttgaccacagagaccctctggaacaggtagcagtg
ctggcatctttgggaatcttctcttttctgggactggcagctggggccctggcactgggg
ctctggctgagactgagaccagatgggaaggatgcaccccaaaagcctaggttcttggct
ccagtgattccagtggacaagcttccaggggagatcaagaaatcagtatgctga

KEGG   Ursus arctos horribilis: 113260507
Entry
113260507         CDS       T05909                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha isoform X1
  KO
K05059  ciliary neurotrophic factor receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260507 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260507 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113260507 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
    113260507 (CNTFR)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113260507 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:uah00537]
 Receptors
  113260507 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 113260507
NCBI-ProteinID: XP_026362124
UniProt: A0A3Q7WB68
LinkDB
Position
Unknown
AA seq 372 aa
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKMMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTTHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLISVPVTLAL
AAAATTANSLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgctgtgctcgctgccgccgccgccgttgtc
tacgcccagagacacagtcctcaggaagcaccccacgtgcagtatgagcgcctcggttcc
gatgtgactctgccatgtgggacagcaaactgggatgcagcagtgacatggagggtaaat
gggacagacctggcccctgacctgctcaatggctctcagcttgtgctccatggcttggaa
ctgggccatagtggcctctatgcctgcttccaccgtgactcttggcacctgcgccaccaa
gtcctcctacatgtgggcttgccgccgcgggagcctgtgctcagctgccgttccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacctacatccccaacacc
ttcaatgtgaccgtgctgcacggctccaaaatgatggtctgtgagaaggacccagccctc
aagaaccgctgccacatccgctacatgcacctgttctccaccatcaagtacaaggtctcg
ataagcgtcagcaatgctctgggccacaatgccacagctatcaccttcgacgagttcacc
attgtgaagcctgaccctccagaaaatgtggtagcccgaccagtacccagcaaccctcgc
cggctagaggtgacttggcagaccccttcgacctggcctgaccctgagtcctttcctctc
aagttctttctgcgctaccgacccctcatcctggaccagtggcagcatgtagagctgtca
gatggcacaacgcacaccatcacagatgcctatgctgggaaggagtacatcatccaggtg
gcggccaaggacaatgagattgggacgtggagtgactggagcgtggccgcccatgccaca
ccctggactgaggagccacgacacctcaccacggaggcccaggccccggagaccacgacc
agcaccaccagctcactggcacccccacccaccacgaagatttgtgaccctggggagctg
ggcagcggcggaggaccctcggcacccttcttgatcagtgtccccgtaactctggccctg
gctgctgctgccaccactgccaacagtctcctgatctga

KEGG   Ursus arctos horribilis: 113260881
Entry
113260881         CDS       T05909                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor isoform X1
  KO
K05081  prolactin receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04080  Neuroactive ligand-receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260881 (PRLR)
   04151 PI3K-Akt signaling pathway
    113260881 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113260881 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    113260881 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    113260881 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113260881 (PRLR)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  Prolactin receptor family
   113260881 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind IL6Ra-bind fn3 Tissue_fac Interfer-bind GHBP
Other DBs
NCBI-GeneID: 113260881
NCBI-ProteinID: XP_026362576
UniProt: A0A3Q7VND4
LinkDB
Position
Unknown
AA seq 625 aa
MKESVASTVVFILLLFLNTSLLNGQSPPGKPEIFKCRSPEKETFTCWWKPGEDGGLPTNY
TLTYRKEGETTTHECPDYISSGPNSCYFNKKHTSIWTMYIITINATNQMGSSSSDPRYVD
VTYIVEPDPPVNLTLELKQPEDKKPYLWMKWYPPTLVDVRSGWLTLQYEIRLKPEKATEW
ETHFAGQQTQFKILSLYPGQKYLVQVRCKPDHGFWSEWSPESSIQIPNDVTMKDTIVWIF
VAVLSAVICLIMVAAVALKGHSMVTCILPPVPGPKIKGFDTHLLEKGKSEELLSALGCQD
FPPTSDCEDLLVEFLEVDDSEDQQLMPAHSKEHPGRDTKPTPLDPDSDSGRGSCDSPSLL
SKKCEEARVNPSTFHTPEGIEKPENPPAKVTRTRDPQSTRLEGKIPYFPADGSRSSTWPL
PQPPSQHSPRSSYHSVAEVCQLAMGPGGASSTPLDKTDAHALRSPKPTEPGGEEKAAERR
EVESFRSKTDQGTAWLLPQEKSPFISVKPLDYVEIHKVNKDGALSLLPKQKENSNQAEKA
CAPETSKEYAKVSRVMEDNILVLVQAPQAQSLAAFEEPDKEAPPSLPQNPAGEDLASFAS
APGGCGLQLGGLDYLDPTCFTHSFQ
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgaaggaaagtgtggcatccacagttgttttcattttgctactttttctcaacaccagt
ctcctgaatggacaatcacctcctggaaaacctgagatctttaaatgtcgttctcctgaa
aaggaaacattcacctgctggtggaagcctggggaagatgggggacttcctactaattac
acgctgacgtaccgcaaggaaggagagacaaccacacatgaatgtccagactacataagc
agtggccccaattcctgttacttcaacaagaagcacacctccatatggacaatgtacatc
atcacaataaatgccacaaaccagatgggaagcagttcctcggatccacgttatgtggac
gtgacttacatagttgaaccagaccctcctgtgaacctaactttggaattaaaacaacca
gaagacaaaaaaccgtatctgtggatgaaatggtacccacccaccctggttgatgttaga
tctggttggctcacactccagtatgaaattcggttaaaacccgagaaagcaactgagtgg
gagactcattttgctgggcagcagactcagtttaagattctcagcttatatccaggacag
aaataccttgtccaggttcgctgcaagccagaccatggattctggagtgagtggagccca
gagagctctatccagatacctaatgatgtcaccatgaaagataccatcgtgtggatcttt
gtggccgttctttctgccgtcatctgtctgattatggtcgcagcagtggctttgaaaggc
catagcatggtgacctgcatccttccaccagttcctgggccaaaaataaagggatttgat
actcatctgctggagaagggcaagtctgaagaactgctgagcgccctggggtgccaagac
ttccctcccacttcggactgtgaggacttgctggtggagtttttagaagtggatgacagc
gaggaccaacagctgatgccagcccattcgaaagaacacccgggtcgagatacgaagccc
acgcccctggatccagacagcgactctggccggggcagctgcgacagcccttcccttttg
tctaaaaagtgtgaggaagcccgggtgaatccctccacatttcacactcccgagggcatc
gagaagccagagaatcccccagcaaaggtcacccgcactcgggacccccagagcacacgc
ctggaaggcaaaatcccctatttccctgccgacggatccagatcttcaacgtggccttta
ccgcagccccccagccagcacagccccagatcttcttaccacagcgtcgctgaggtgtgt
cagctggccatgggcccggggggggcctcgagcactccgctggacaaaacagacgcacat
gctttaagatctccaaaacccaccgagcctggaggggaggagaaggcagctgagcggagg
gaagtggaaagcttccgttccaagactgaccaaggcacagcatggctgttgccccaggag
aagagccctttcatctctgtgaaacccttggattacgtggagattcacaaggtgaacaaa
gatggagcgctatccctgctcccaaaacagaaagagaacagcaaccaggcagagaaggcc
tgtgctcctgaaaccagtaaggagtacgccaaggtgtccagggtgatggaggacaacatc
ctggtgttggtgcaggctccgcaagctcagagcctggctgcgtttgaagaaccagacaag
gaggccccgccgtccctgccgcagaatccagccggagaagacctggcctccttcgcctcg
gccccaggaggctgtggactccagctgggggggttggattacctggatcccacgtgtttt
acgcactcctttcagtga

KEGG   Ursus arctos horribilis: 113260884
Entry
113260884         CDS       T05909                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04068  FoxO signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
uah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260884 (IL7R)
   04068 FoxO signaling pathway
    113260884 (IL7R)
   04151 PI3K-Akt signaling pathway
    113260884 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260884 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113260884 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260884 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    113260884 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113260884 (IL7R)
   04090 CD molecules [BR:uah04090]
    113260884 (IL7R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113260884 (IL7R)
CD molecules [BR:uah04090]
 Proteins
  113260884 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 113260884
NCBI-ProteinID: XP_026362582
UniProt: A0A3Q7XJ78
LinkDB
Position
Unknown
AA seq 456 aa
MTILGTAFGMVFYLLQAVSGESGYAQNGEFEDAELDDYSFSCYSQLEVDGTQHLLTCAFD
DPDINSTNLEFEICGALLNVKCLTFDKLQDMYVIKTKKFLLIGDSEIYVKLGGKNITSKK
LNIVEIVKPEAPFDIRVIYRKGANDFLVTFNTSHSQKKYVKELMHEVAYRQEKKENDWMR
VNLSSTKLTLLQRKLQPDAMYEIKVRSIPNANYFQGFWSEWSPTFHFRTPEITGRMDPVL
LTISILSFFSVALMVILACALWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFHPES
FLDCQIHKVDGIQARDEAESFLQDTSPQLDESEKQRLGGGTQGPTWPSEHAVITPKTFRG
DSPFGCLAGSISMCEALVQPSSRFPDCGEGGKNGPHVYQGLLPGPGTTNSTVPAPFPFQS
GILTLNQAAQGQPVLTSLGSSQEEAYVTMSSFYQNQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgacgattctgggtacagcttttggtatggttttctatttacttcaagccgtttctgga
gaaagtggctatgcacagaatggagagtttgaagatgccgagctggatgactattcattc
tcttgctacagtcagttggaagtggatggaacccagcacttgctgacctgtgcttttgat
gacccggacatcaacagcaccaatctggaatttgaaatatgtggagcccttttgaatgta
aaatgcctgacttttgataaactgcaagacatgtatgtcattaagacaaagaaattctta
ctcattggagacagcgaaatatatgtgaagcttggaggaaagaacataacttccaagaaa
ttgaacatagttgagatagttaaacctgaggctccttttgacataagagtcatctatcgc
aaaggagcaaatgactttctggtgacatttaacacatctcactcacaaaagaagtatgtg
aaagaattaatgcatgaagtagcctatcgccaggaaaaaaaggaaaatgactggatgcgt
gtgaacttatccagtacaaagctgacactcctacagagaaagctacaacctgatgcaatg
tatgagattaaagtccggtccatccctaatgccaactattttcaaggcttctggagtgaa
tggagtccaaccttccacttcagaactccagagatcacagggaggatggatcctgtttta
ctaactattagcattctgagtttcttctctgtggctctgatggtcatcttggcctgtgca
ttatggaaaaaaagaattaaacctattgtgtggcccagtctccccgatcataagaagact
ctggaacaactgtgcaagaaaccaaaaaagaatttgaatgtgagtttccatcctgaaagc
ttcctggactgccagattcataaggtggatggcattcaagctagagatgaagcagaaagc
tttctgcaagacacttctccacaactagatgagtctgaaaagcagagacttggagggggt
acgcagggacccacctggccatcggagcatgcagtcatcaccccaaaaactttcagagga
gattcacccttcggatgcctggctgggagcatcagtatgtgtgaggcccttgtgcaaccc
tcatccaggttcccagactgtggggaaggtggcaagaatgggcctcatgtgtaccagggc
ctgctgcctggccctggaactacaaacagcactgtgcccgctccatttcctttccagtca
ggaatcctgacactgaaccaagctgcccagggacagcctgtgctcacttccttgggatca
agtcaggaggaagcatatgtcaccatgtccagcttctaccaaaaccagtga

KEGG   Ursus arctos horribilis: 113260908
Entry
113260908         CDS       T05909                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor isoform X1
  KO
K05058  leukemia inhibitory factor receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260908 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260908 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113260908 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113260908 (LIFR)
   04090 CD molecules [BR:uah04090]
    113260908 (LIFR)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113260908 (LIFR)
CD molecules [BR:uah04090]
 Proteins
  113260908 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 Pur_ac_phosph_N IL6Ra-bind TMEM154 DUF3827
Other DBs
NCBI-GeneID: 113260908
NCBI-ProteinID: XP_026362633
UniProt: A0A3Q7WM78
LinkDB
Position
Unknown
AA seq 1097 aa
MMDISLRLRRPSWMVDSKRMRRTSHFQWLLLTFILLYLMNQVNSQKRGAPRDLKCITNNL
QVWDCSWRAPSGAGHGTVYEICIENRSYSCYQSEKTNTKIPALLPGDHEITINRLYDFGN
LISKFTLNEKNVSLIPDTPEILNLSADFSTSTLHLKWNDRGSVFLHHLNVIWEIKILRKE
NMEIVKLLTHNTTMNGKDAVHHWSWTSDMPLECATHSVGIRCYVDDPHFSGRKEWSDWSP
LKNVSWSPDSQTKVFPQDKVILVGSDITFCCVTQEKVLSAQIGQTNCPLIHLDGENVAIK
IHNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDIPQKLNCETYDLKEIVCTWNPGRPTA
LVGPRNTSYTLFESFSGKYVRFKRVEAPTNESYQLFFQMRPNQEIYNFTLNARNPLGRSE
STILVNITEKVYPHIPTSVKVKDINSTAVTLSWHLPGNFAKIKLLCQIEINKTNSVQELR
NVTIKGVENSSYLVAVDKLNPYTIYTFRIRCSTETFWKWSRWSNEKKYLTTEAIPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSLDEETQSLSEIPDPQHKAELQLDK
NDYIISVVAKNSAGSSPPSKIASMEIPNDDLKVEEAVGMGNGILLTWNYDPNMTCDYVIK
WCNSSRSEPCLMDWKKVPSNSTETVIESDQFRPGVRYSFFLYGCRNQGYQLLRSIIGYIE
ELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFEKGERDTSKIRGLESGR
SDIKVKNITDLSQKTLRIAALQGKTSYHLVLRAYTDGGMGPEKSMFVVTKENSVGLIIAI
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGNSALKTLEM
NPCTPNNVEVLETRSALPKIEDTEIISPVAERPEESSDAEPENHVVVSYCPPVIEEETPN
PGADEAGGTSQVVYIDIQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPVPAAVEDLAAED
DFDKSAGYRPQADVTTWNLVSPDSPRSTDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKS
NGGGWSFTNFFQNKPND
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgatggacatttccttacgtttgagaagaccatcctggatggtggatagtaaaagaatg
aggaggacttcacatttccagtggctcttattaacatttattctcctgtacttaatgaac
caagtaaatagccagaaaaggggggcgcctcgtgatttgaagtgtataactaacaatttg
caagtgtgggactgttcttggagagcaccctctggagcaggccatggtactgtttatgaa
atttgcatcgaaaacaggtcttattcttgctatcaatcagagaaaacaaatactaaaatc
cctgctcttttacctggtgatcatgaaataacgataaaccgtctatatgattttggaaat
cttataagtaaattcacattaaatgaaaaaaatgtttccttaattccagatactccagag
atcttgaatctgtctgctgatttctcaacttccacattacacctaaagtggaatgacagg
ggttctgtttttctacatcacttaaatgtcatctgggaaattaaaattctacgtaaagaa
aatatggaaatcgtaaaattactgacccacaacacaactatgaatgggaaagacgcagtt
catcactggagttggacctcagacatgcccttggagtgcgccactcattctgtgggaatt
agatgctatgttgatgatcctcatttctctggtcgcaaagagtggagtgactggagccca
ctgaagaacgtttcttggtcacctgattctcagactaaggtttttcctcaagacaaagta
atactagtaggttcagatataacattttgttgtgtgactcaagaaaaagtgttatcagca
cagattggccaaacaaattgtccccttatccatcttgatggggaaaatgtggcaatcaag
atccataatatttctgtttctgcaagtagtggaacaaatgtggttttcacaacagaagat
aacatatttgggacagttatttttgcaggatatccacctgatattcctcaaaaactgaat
tgtgagacctatgatttaaaagagattgtctgtacttggaatccaggaagaccaaccgca
ttggtgggcccacgcaatacaagttatactttatttgaaagtttttcagggaaatatgtt
agatttaaaagagttgaagcaccaacaaatgaaagctatcagttattctttcaaatgcgt
ccaaatcaagaaatatataattttactttgaatgctcgcaatcctctgggtcgatcggaa
tcaactattttagttaacataactgaaaaagtctatcctcatattcctacttcagtcaaa
gtgaaggatattaattcaacagctgttacactttcctggcatttaccaggcaactttgca
aagattaaacttttatgtcaaattgaaattaacaaaactaactcagtccaagaattgcgg
aatgtcacaatcaaaggagtagaaaattcaagttatcttgtagctgtggacaagttaaat
ccatacactatatatacttttcggattcgctgttctaccgaaactttctggaaatggagc
agatggagcaatgaaaagaaatatttaaccacagaagccattccttcaaagggaccagac
acgtggagagagtggagttctgatggaaaaaatttaataatctattggaagcccttaccc
attaatgaagcaaatgggaaaatactttcctataatgtatcatgttcactcgatgaggag
acacagtccctttctgagatccctgatccccaacacaaggcagaactacaacttgataaa
aacgactacatcatcagtgtggtggcaaaaaattccgccggctcgtcgccgccttctaag
atagctagtatggagatcccaaacgatgatctcaaagtagaggaggctgtcggaatggga
aatggaattctcctcacttggaattacgatcccaatatgacctgtgactatgttattaaa
tggtgtaactcatctcggtctgaaccctgccttatggactggaaaaaagtcccttcaaac
agcactgaaactgtaatagaatctgatcagtttcgaccgggtgtaagatacagttttttt
ctgtatggctgcagaaatcaaggatatcagttattacgttctataattggatatatagaa
gaactggctccgatcgttgcgccaaattttactgtggaggatacatctgcagattcgata
ttagtgaaatgggaagatattcctgtggaggagctcagaggctttttaagaggatattta
ttttactttgaaaaaggagagagagacacatctaaaataaggggtttggaatctggtcgg
tctgacataaaggttaagaatattactgacctgtcccagaagacactgagaattgctgct
cttcagggtaaaacaagttaccacctggtcttgcgagcctatacagatggcggcatgggc
ccggagaagagcatgtttgtggtgacgaaggaaaattctgtgggattaattattgccatt
ctcatcccagtggcggtggctgtcattgtgggagtggtaacgagtatcctttgctatcgg
aaacgagaatggattaaagaaaccttctaccctgatattccaaatccagaaaactgtaaa
gctctacagtttcaaaagagtgtctgtgaggggaacagtgctctcaagacattggaaatg
aatccttgtaccccaaataatgttgaggttctggaaactcgctcagcacttccgaaaata
gaagacacagaaataatctctcccgtagccgagcgcccagaagaaagctctgatgcagaa
cccgagaaccacgtggtcgtgtcctactgcccccctgtcattgaggaggaaacgccgaac
ccgggcgcggatgaggccggagggacctctcaggtcgtttacattgatatccagtctatg
taccagcctcaggcgaaaccagaggaggaacaagaaaacgaccctgtggggggcgccggc
tataagccacaaatgcacctgcccgtccctgctgccgtggaagacctcgccgcagaggac
gacttcgataaaagtgcaggctacagacctcaggcagatgtaactacttggaacttagta
tctccagactctccccgatccacagacagcaacagtgaaattgtctctttcggaagcccc
tgctccattaactcccgacaatttttgattcctcctaaagatgaagactctccgaaatcg
aatgggggcgggtggtcctttacaaacttctttcagaacaaacccaacgactaa

KEGG   Ursus arctos horribilis: 113260912
Entry
113260912         CDS       T05909                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta isoform X1
  KO
K05057  oncostatin M receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260912 (OSMR)
   04151 PI3K-Akt signaling pathway
    113260912 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260912 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113260912 (OSMR)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL6/12 receptor family
   113260912 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 Pur_ac_phosph_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 113260912
NCBI-ProteinID: XP_026362636
UniProt: A0A3Q7VNJ7
LinkDB
Position
Unknown
AA seq 968 aa
MALFSVFQTTFLLASLSLRTYQSEVWSEPLPWAPESLKVSINSTRQCLHLQWSVHNLAYH
QELKMVFQIEISRIKTSNVIWVEDYSTTVKWNQVLHWSWESKLPLECAKHFLRMRSAVDD
AKTPEQRFWSNWSSWEEVDVQNSLGHEPLFVFPKDKLVEEGSNVTICYVSRSQQNNISCY
LEGVRMQGEQLGPNVSMFNLNHVAFIRETGTNIYCKVDQGDGIKGIVLFVSKVLEEPKDF
SCETQDLMTLNCTWDPGRDTGLLKQLSQSYTLFESFSGKKTLCKHKSWCSWQVAPESQET
YNFTLTAENYLRKRSVYLLFNLTHRVHPKAPFNVLFKNVSATNATMTWKVHTIGNYYTLL
CQVDLYGEGKVTQHNISVKVDGEHLFGGLEPDTQYMAQVRCANANRFWKWSEWTCQNFTT
AEAAPSEAPDVWRNVKSVQGDCVVTLFWKPLSKLQANGKILFYNIVIENLDRSSISKLLS
IPAPANGTEVILDQCLYQIHVTANNSVGTSPASVIIVSGDPGNTEVEEERVKGTEDGFSL
SWKPQPRNVTGYIVDWCDHPRDPLCDLQWKNLGPNTTSTVVSSGAFRPGVRYNFRIYGIS
TESVPYLLEKKTGYSQELAPSDNPQVVMSNLTSHSFTLSWKDYSTESQPSFIQGYHVYLK
SKVGQCHSGWEKAVLSDDAVCCKYKIDNPKQKTFVVENLQPESFYEFLVTPYTSVGEGPH
GAFTKVTTPDEYSPILIRIILPMVFCILLLMIICYLKSQWMKEKCYPDIPDPYKSSVLSL
IKSKENPRLTIMNIKDCVPDSIEVLNKQEGTRRSLTETESTKPTYLYLLPTETSYSGPGP
CICFENFTYNQAASDSASCGHVPVPPKAPPSQLGLFTSPENLPKSLEKNYMNSLGEIPAG
ETSLNYVSQLASPTSGDKSSLPTNPPEPALCSEYKMQMAIPLGLASPPSSGSSSLSSITL
LEEGEHYH
NT seq 2907 nt   +upstreamnt  +downstreamnt
atggctctcttttcagtctttcagacaacattcctcttggcatcgctgtccttgagaact
taccagagtgaagtctggtctgaacctttgccgtgggcccctgagtccctgaaagtttct
atcaattctacacgtcagtgtttgcatttacaatggagtgtccacaaccttgcttatcat
caggaattaaaaatggtttttcagatagaaatcagtagaattaaaacatctaatgtcatc
tgggtggaggactatagcactactgtgaagtggaaccaagttctgcattggagctgggaa
tccaagctgcctttggaatgtgcgaaacattttctaagaatgaggagtgcggtggatgat
gccaagacccccgagcagaggttctggagcaactggagttcatgggaggaagtggatgta
cagaattctcttggacacgagccattgttcgttttccctaaagataagctggtggaagaa
ggctccaatgtcaccatttgttacgtttccaggagtcagcaaaataacatatcctgttat
ttggaaggcgtacggatgcagggagaacagcttggtccaaatgtctccatgttcaacttg
aatcatgttgctttcattagggaaaccgggacaaatatctattgtaaggtggaccaagga
gacggtataaagggcatcgtcctctttgtgtcaaaagtccttgaggagcccaaggatttt
tcttgcgaaacccaggacctcatgactttgaactgcacttgggatcccgggagggacact
ggcttgctcaaacagctctcccaaagctacactttatttgaatcattttccgggaaaaag
acactttgtaaacacaaaagctggtgtagttggcaagtagctccagagtcccaagaaacg
tataacttcacgctcacggctgaaaactacttaagaaagagaagtgtttaccttcttttt
aacctgactcatcgagtgcacccaaaggctccctttaatgtattatttaaaaatgtaagc
gccacaaatgccaccatgacctggaaggtacacaccattgggaattattatacactgttg
tgccaggttgacctctatggtgaaggaaaagtgacacaacacaacatttccgtcaaggtt
gatggtgagcacctcttcggtggcctggagccggacacacagtacatggcccaagtgcgc
tgtgctaatgccaaccgcttctggaaatggagtgaatggacgtgccagaacttcaccaca
gctgaagctgctccctcagaggctcctgacgtctggagaaatgtgaagtcagtgcaagga
gattgtgttgtgactttattctggaagccactatcgaaattgcaggccaatgggaagatt
ctgttctataatatagttatagaaaatctagacagatcatccatttcgaagctcctctcc
attcctgctccagccaatggcacagaagtaatccttgatcagtgtttgtaccaaatccac
gtcacagctaataacagtgtgggcacgtcccctgcttcagtcatcatagtctctggagat
cctggaaacacagaagttgaagaagaaagagttaaaggcacagaggacggattctctctg
tcttggaaaccccaacccagaaacgtcacaggctacatcgtggattggtgtgaccatccc
cgggacccgctctgtgatctccagtggaaaaacctaggtcccaataccacaagcacagtt
gttagttcaggtgctttcagaccaggggtccgatacaacttcagaatttatggaatttct
acagaaagcgttccttatttactagagaaaaaaacaggatactcccaggaactggctcct
tcagacaacccgcaagtagtcatgagtaacctgacctcccactccttcactctgagctgg
aaggattattccactgaatcccagcccagttttatacaagggtaccacgtctacctgaaa
tccaaggtggggcagtgccactcaggatgggaaaaggcagttctttcagatgatgcagtg
tgttgcaaatacaaaattgacaacccgaaacaaaagacatttgtcgtggaaaacttacag
ccagaatccttctatgagtttttggtcaccccatacaccagtgttggcgagggcccccat
ggcgctttcacgaaggtcacaactccggatgaatactcccctatactgatccgtatcata
ctccctatggttttctgcattttgctcctcatgatcatatgctacctgaaaagtcagtgg
atgaaggagaagtgttatcctgatattccagacccttacaagagcagtgttctgtcatta
ataaaatccaaggagaatcctcgcctaacaataatgaatatcaaagactgtgttccagac
tctattgaagttctaaacaagcaggaaggcactaggaggtcactcacagaaaccgagtct
accaagcccacctacctttacctccttccaacagagacgagctactccggccccggaccc
tgcatctgttttgagaactttacctataatcaggcagcttctgactctgcttcttgtggc
catgtcccagtaccccctaaagccccaccaagtcagctgggactgtttacatcacctgaa
aatttaccaaagtcattggaaaaaaactacatgaactccctgggagaaattccagctgga
gaaactagtttaaattatgtgtcccagttggcttcacccacgtctggagacaagtccagt
ctccccacaaatccaccagagccagcactctgttcagagtacaaaatgcaaatggccata
cccttgggtcttgcctctcctccctcgagtgggagtagcagcctctcttccattaccctt
ttagaggaaggtgaacactaccactaa

KEGG   Ursus arctos horribilis: 113260944
Entry
113260944         CDS       T05909                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor isoform X1
  KO
K05080  growth hormone receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04080  Neuroactive ligand-receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260944 (GHR)
   04151 PI3K-Akt signaling pathway
    113260944 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113260944 (GHR)
   04060 Cytokine-cytokine receptor interaction
    113260944 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    113260944 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113260944 (GHR)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  Prolactin receptor family
   113260944 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 DUF4605
Other DBs
NCBI-GeneID: 113260944
NCBI-ProteinID: XP_026362678
UniProt: A0A3Q7WMB5
LinkDB
Position
Unknown
AA seq 646 aa
MRAAGPTGMDLWQLLLTLAVAGSGNAVSGSEATPAILGRASQSLQRVNPGPGTNPSGKPQ
FTKCRSPELETFSCHWTKGVHHGVKNPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSC
YFNSSYTSIWIPYCIKLTSNGDTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQ
VRWEPPPNADVQKGWIVLEYELQYKEVNESQWKMMDPVLSTSVPVYSLRLDKEYEVRVRS
RQRNSEKYGEFSEVLYVALPQMSPFACEEDFQFPWFLIIIFGIFGLTMILFLFIFSKQQR
IKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKPEFYNDDSWVEFIELDIDD
PDEKTEGSDTDRLLSNDREKSLNILGAKDDDSGRTSCYEPDILETDFNASDVCDGTSEVA
QPQRLKGEVDLLCLDQKNQSNSPSTDTAPTTQQPGVILAKENKPRPLLISGTESTHQAAH
PQLSNPSSLANIDFYAQVSDITPAGSVVLSPGQKNKAGIAPCDMPPEVVSLCQANFIMDN
AYFCEADAKKCITVAPHVEAESCVEPSFNQEDIYITTESLTTVAGQPGTAERAPSSEMPV
PDYTSIHIVQSPRGLVLNATALPLPDKEFLSSCGYVSTDQLNKILP
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgagagctgcgggtcctacaggtatggatctctggcagctgctgttgaccttggcagtg
gcaggctcaggcaatgctgtttctgggagtgaagccacaccagctatccttggcagagca
tcccagagtctgcaaagagttaatccaggcccagggacaaatccttctgggaagcctcag
ttcaccaagtgccgttcacctgaactagagaccttttcatgccactggacaaagggggtt
catcacggtgtgaagaacccaggatccatacagctgttctatattagaaggagcactcaa
gaatggactcaagaatggaaagaatgtcccgattatgtctctgctggagaaaacagctgt
tactttaattcatcttatacctccatttggataccctactgtatcaagctaaccagcaat
ggtgatacagtggatcaaaaatgtttctctgttgaggaaatagtgcaaccagacccaccc
atcggcctcaactggactttactgaacatcagtttaacggggattcatgcggatatccaa
gtgagatgggaaccaccacccaacgcagatgtccagaagggttggatagtcctggagtat
gagctgcaatacaaagaagtaaacgagtcccagtggaaaatgatggaccctgtattgtca
acatcagttccagtttactcattgagactggataaggaatatgaagtgcgtgtgagatcc
agacaacgaaattctgaaaaatatggcgagttcagtgaagtgctgtatgtagcacttcct
cagatgagtccatttgcatgtgaagaagatttccagtttccatggttcttaattattatc
tttggaatatttgggctaacgatgatactatttttattcatattttctaaacagcaaagg
attaagatgctgattcttcccccggttccagttccaaagattaaaggaattgatccagat
ctcctaaaggaaggaaaattagaagaggtgaacacaatcttagccattcatgacaactat
aaacctgaattctacaacgatgactcttgggttgaattcattgagctggatattgatgac
ccagacgaaaagactgaaggatcagacacagacagacttctcagcaacgaccgtgagaag
tcactcaacatccttggagcaaaggatgatgactctggacgtaccagctgttatgaacct
gacattctggagactgatttcaatgccagtgacgtgtgcgatggtacatcagaagttgct
cagccacagaggttaaaaggggaagtagatctcttgtgccttgaccagaagaatcaaagt
aactcaccttctactgatactgcccctaccactcagcagcccggcgttatcctggcaaag
gaaaacaagccaagaccacttctgattagtggaaccgagtcaactcatcaagctgcccat
cctcagctaagcaatccgagttcactggcaaacatcgacttttatgcccaggtaagcgac
attactccagcagggagtgtggtcctttccccaggccaaaagaataaggcagggatagcc
ccgtgtgacatgcctccggaagtggtctcgctctgccaggcaaacttcatcatggacaac
gcctacttctgcgaggcagatgccaaaaagtgcatcactgtggcgcctcacgtcgaggct
gaatcatgtgtagagccaagctttaaccaggaagacatttacatcaccacagaaagcctt
accactgtcgctggccagcctgggacagcagagcgggctccgagctctgagatgcctgtc
ccggactatacctccatccacatcgtacagtctccacggggcctcgtgctcaatgccacg
gccttgcccttgcctgacaaagagtttctctcatcgtgcggctacgtgagcacagaccaa
ctgaacaaaatcctgccgtag

KEGG   Ursus arctos horribilis: 113262493
Entry
113262493         CDS       T05909                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04020  Calcium signaling pathway
uah04072  Phospholipase D signaling pathway
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04630  Jak-STAT signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05163  Human cytomegalovirus infection
uah05200  Pathways in cancer
uah05206  MicroRNAs in cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113262493 (PDGFRA)
   04015 Rap1 signaling pathway
    113262493 (PDGFRA)
   04010 MAPK signaling pathway
    113262493 (PDGFRA)
   04630 Jak-STAT signaling pathway
    113262493 (PDGFRA)
   04020 Calcium signaling pathway
    113262493 (PDGFRA)
   04072 Phospholipase D signaling pathway
    113262493 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    113262493 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113262493 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113262493 (PDGFRA)
   04540 Gap junction
    113262493 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113262493 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113262493 (PDGFRA)
   05206 MicroRNAs in cancer
    113262493 (PDGFRA)
   05230 Central carbon metabolism in cancer
    113262493 (PDGFRA)
   05231 Choline metabolism in cancer
    113262493 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    113262493 (PDGFRA)
   05218 Melanoma
    113262493 (PDGFRA)
   05215 Prostate cancer
    113262493 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113262493 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113262493 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113262493 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113262493 (PDGFRA)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113262493 (PDGFRA)
Protein kinases [BR:uah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   113262493 (PDGFRA)
CD molecules [BR:uah04090]
 Proteins
  113262493 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set Kinase-like
Other DBs
NCBI-GeneID: 113262493
NCBI-ProteinID: XP_026364667
UniProt: A0A3Q7XP90
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSLLAFLILGSLLTGPSRVFCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVAVLEVVSAAAAHTGLYTCYYNHTQTEETDIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLRSNDGVVHASYDSRQGFNG
TFSVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLRVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWAILANNISNIITEVHPRD
RSTVEGRVTFTRVEETIAVRCLAKNLLGAESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRSY
VILSFENNGDYMDMKQADATQYVPMLERKEAAKYSDIQRSLYDRPASSKKKSVLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGSLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccttctggccttcctgatcttaggctctctcctcacagggcccagccga
gtcttctgccagctttcattaccctccatcctgccaaacgaaaatgaaaaggtcgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagaaacgaggagaacaacagcggcctt
tttgtggccgtgctggaggtggtcagcgcggcggcggcgcacacgggcttgtacacctgc
tattacaaccacacccagacggaggagaccgacatcgagggcaggcgtatctacatctac
gtgccagacccggatgtagccttcgtgcctctgggaatgacagattatttagtcatcgtg
gaggatgatgattctgccatcataccttgtcgcacgactgatcccgagactccggtcacc
ttgcgcagcaatgacggggtggtgcacgcctcctatgacagcagacagggcttcaatggg
accttcagcgttgggccctatatctgtgaagccaccgtcaggggaaagaagttccagacc
atcccatttaatgtttatgctttaaaagcaacgtcagaacttgatctagaaatggaagct
cttaaaactgtgtataagtcaggggagacgattgtggtcacctgcgccgtctttaacaac
gaggtggtcgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcaccatg
ctggaggaaatcaaggtcccgtccatcaaattggtgtatactctgagggtccccgaggcc
acggtgaaagatagtggagattatgaatgtgctgcccgccaggccaccaaggaggtcaaa
gagatgaagaaagtcaccatttctgtccatgagaaagggttcattgaaatcaaacccaac
ttcagcccgttggaagctgtcgacctgcatgaagtcaaacatttcgtggtggacgtgcag
gcctacccccctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
acggagatcaccacggacatagaaaagattcaggaaataaggtatcggagcaaattaaag
ctgatccgtgctaaggaggaagacagtggccattacacgatcgtcgttcaaaatgaagat
gacgtgaagagctatactttcgaactcctaactcaagttccctcatctattctggacttg
gtggacgaccaccacggctccacggggggacagaccgtgagatgcaccgccgaagggacg
cctcttcctgatatcgagtggatgatttgcaaggatattaagaagtgtaataatgaaact
tcatgggcgattttggccaacaatatctcaaacatcatcacggaggtccacccccgagac
aggagcactgtggagggccgagtgacgttcaccagagtggaggagaccatcgccgttcga
tgtctggccaagaatctccttggggccgagagccgcgagctcaagctggtggctcccacg
ctgcgctctgagctcacggtggctgctgccgtcctcgtgctgctggtgattgtcatcatc
tccctcatcgtcctggtcgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatccatcagcccggatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctggga
tctggcgcgtttgggaaagtggttgaaggaactgcctatggattaagccgctcccagcct
gtcatgaaggtagcagtgaagatgctgaaacccacagccagatccagtgagaaacaggct
cttatgtcggaactgaagataatgactcacctggggccgcatttaaacattgtgaacttg
ctgggagcctgtaccaagtcaggccctatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggatagcttcctgagccgccacccggagaag
ccaaagaaagagctggacatttttggattgaaccctgccgacgacagcacacggagttac
gtcattttatcttttgaaaacaacggtgactacatggacatgaagcaagctgacgccacc
cagtacgtccccatgctggaaaggaaagaggctgccaagtactcagacatccagagatcg
ctgtatgatcgcccggcctcgtctaagaagaagtctgtgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttgagctttacctat
caagttgcacgaggaatggaatttttggcttcgaaaaattgtgtccaccgggacctggct
gctcgaaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgacttcggcctggcc
agagacatcatgcacgattcgaactacgtgtcgaaaggcagtacctttctccctgtgaag
tggatggcccctgagagcatcttcgacaacctctacaccacactgagtgacgtctggtct
tacggcattctgctctgggagatcttttccctcggcggcacaccctaccccggcatgatg
gtggattctactttctacaataagattaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctacgagatcatggtgaaatgctggcacagtgagccggagaagaga
ccctccttctaccacctgagtgagattgtggagaacctgctgcccggacagtataagaag
agttacgaaaagattcacctggacttcctgaagagcgaccaccccgccgtggcgcgcatg
cgcgtggacgccgacaacgcctacattggcgtcacctacaaaaacgaggaagacaagctg
aaggactgggagggcagcctggacgagcagaggctgagcgcggacagcggctacatcatc
cccctgcccgacatcgaccctgtccctgaggaggaagacctgggcaagaggaacagacac
agctcgcagacctcagaagagagtgctatcgagacaggttcgagcagctccaccttcatc
aagagagaggacgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcagacctggtagaggacagcttcctgtga

KEGG   Ursus arctos horribilis: 113263944
Entry
113263944         CDS       T05909                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah04010  MAPK signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04020  Calcium signaling pathway
uah04072  Phospholipase D signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04630  Jak-STAT signaling pathway
uah04810  Regulation of actin cytoskeleton
uah05165  Human papillomavirus infection
uah05200  Pathways in cancer
uah05206  MicroRNAs in cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05218  Melanoma
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113263944 (PDGFRB)
   04015 Rap1 signaling pathway
    113263944 (PDGFRB)
   04010 MAPK signaling pathway
    113263944 (PDGFRB)
   04630 Jak-STAT signaling pathway
    113263944 (PDGFRB)
   04020 Calcium signaling pathway
    113263944 (PDGFRB)
   04072 Phospholipase D signaling pathway
    113263944 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    113263944 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113263944 (PDGFRB)
   04540 Gap junction
    113263944 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113263944 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113263944 (PDGFRB)
   05206 MicroRNAs in cancer
    113263944 (PDGFRB)
   05230 Central carbon metabolism in cancer
    113263944 (PDGFRB)
   05231 Choline metabolism in cancer
    113263944 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    113263944 (PDGFRB)
   05218 Melanoma
    113263944 (PDGFRB)
   05215 Prostate cancer
    113263944 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113263944 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113263944 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113263944 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113263944 (PDGFRB)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     113263944 (PDGFRB)
Protein kinases [BR:uah01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   113263944 (PDGFRB)
CD molecules [BR:uah04090]
 Proteins
  113263944 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set C2-set_2 Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 113263944
NCBI-ProteinID: XP_026366541
UniProt: A0A3Q7XTU7
LinkDB
Position
Unknown
AA seq 1100 aa
MQLPSAVPAPVLKGQVLLLPLLLLLGPQASWGLVISPPGPELILNVSSNFVLTCSGPAPV
VWERMSQEPLQKMAKTQDGTFSSTLTLTNVSGIDTGEYFCTYKGSHGLEPGERKRLYIFV
PDPLMGFLPVDPEELFIFLTEITEITIPCRVTDPRLVVTLHEKKVDIPLPIPYDHQRGFS
GTFEDKTYVCKTTIGDKEVDSEAYYVYSLQVSSINVSVNAVQTVVRQGENITIMCIVTGN
EVVNFEWTYPRMESGRLVEPVTDFLFNMPSHIRSILHIPSAELGDSGTYICNVSESVNEH
RDEKSINVTVVESGYVRLLGELDAIQFAELHRSRTLQVVFEAYPPPTVMWFKDNRTLGDS
SAGEISLSTRNVSETRYVSELTLVRVKVAEAGCYTMRAFHEDAEAQLSFQLQVNVPVRVL
ELSENHPASGEQTVRCRGRGMPQPHLTWSTCSDLKRCPRELPPTPLGNSSEEESQLETNV
TYWPEEQEFEVVSTLRLRRVDQPLSVRCTLHNLLGHDMQEVTVVPHSLPFKVVVISAILA
LVVLTIISLIILVMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRCPDKRRPPSAELYSNAL
PGGLPLPSHVSLPGESDGGYMDMSKDESVDYVPMLAMKGGVKYADIESSSYMAPYDNYVP
TAPERTCRATLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAVLRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLESSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPQPEPQGEP
EPPLESSCPGPRAEAEDSFL
NT seq 3303 nt   +upstreamnt  +downstreamnt
atgcagcttccgagcgcagtgccagctcctgtcctcaaaggccaggtgctactgctgccc
ctgctgttgctgctgggcccacaggcctcctggggcctggtcatctcacccccggggcca
gagcttatcctcaatgtctccagcaacttcgtgctgacctgctcaggtccagctccggtg
gtgtgggaacggatgtcccaggagcccctgcagaaaatggccaagacccaggatggcacc
ttctccagcacactgacactgaccaatgtctctgggatagacacgggagaatacttttgc
acctacaaaggctcccatgggctggagcctggggagcggaaacggctctacatctttgtg
ccagatcccttgatgggctttctcccggtcgaccccgaggaactattcatcttcctcacg
gaaataactgagatcacaattccatgccgagtgacggatccgagactggtggtgacactg
cacgagaagaaagtggatatcccgctgcccattccctatgaccaccaacgtggcttctct
ggtacctttgaggacaagacctatgtctgcaaaaccaccatcggggacaaggaagtggat
tctgaagcctactatgtctacagcctccaggtgtcatccatcaatgtgtcagtgaatgca
gtgcagactgtggtccgtcagggtgagaacatcaccatcatgtgcattgtgactggaaat
gaggtggtcaacttcgaatggacatacccacgcatggagagcgggcggctggtggagcca
gtgactgacttcctcttcaatatgccctcccacatacgctccatcctgcacatccctagt
gctgagcttggcgattcagggacctacatctgcaatgtatcggagagcgtgaatgagcat
cgagatgaaaagtccatcaatgtcactgtggttgagagtggctacgtgcggctgctggga
gagctggacgccatacaattcgcggagctgcaccgcagccggactctgcaggtcgtgttc
gaggcctacccgccgcctactgtcatgtggttcaaggacaaccgcacgctaggcgactcc
agcgcaggcgagatctccctgtccacacgcaatgtgtctgagacccggtacgtgtcagaa
ctgacgttggtgcgggtgaaggtggccgaggcgggctgctacaccatgcgggccttccat
gaggacgcggaggcccagctctccttccagctgcaggtcaacgtgcctgtccgtgtgctg
gagctgagtgaaaaccaccctgccagcggggagcagacagtccgctgtcgcggcaggggc
atgccccagccacacctcacctggtctacctgcagcgacctcaaaagatgtccgcgtgag
ctgccgcccacgccgctggggaacagttcggaggaggagagccagctggagactaacgtg
acgtactggcccgaggagcaggagttcgaggtggtgagcacactgcgcctgcgccgtgtc
gatcagccgctgtcagtgcgctgcactctgcacaacctgctgggacacgacatgcaggag
gtcaccgtggtgccgcattctctgcccttcaaggtggtggtgatctcagccatcctggcc
ttggtggtcctcacaatcatctccctcatcatcctcgtcatgctctggcagaagaagcca
cgttacgagatccgatggaaggtgattgaatccgtgagctccgacggccatgagtacatc
tacgtggaccctatgcagctgccctacgactccacctgggagctgccgcgggaccagctt
gtgcttggacgcaccctcggttctggggcctttggccaggtggtagaggccacggctcac
ggcctgagccattcgcaggccacgatgaaagtggcggttaagatgctgaaatccacagcc
cgcagcagcgagaagcaggccctcatgtccgagctgaagatcatgagtcacctcgggccc
catctgaacgtggtcaacttgctgggggcctgcaccaaaggaggacccatctacatcatc
accgagtactgccgctacggcgacctggtcgactacctgcaccgcaacaagcacaccttc
ctgcagcgctgccccgacaagcgccgcccgcccagcgccgagctctacagcaacgcgctg
cccggcgggctcccgctgcccagccacgtgtctctgcccggggagagcgacggcggctac
atggacatgagcaaggatgagtccgtggactacgtgcccatgctggccatgaaaggaggc
gtcaaatacgcagacatcgagtcctccagctacatggccccttacgacaactacgtcccc
actgctcctgagaggacctgtcgggcaactctgatcaacgagtccccagttcttagctac
acggatctcgtgggcttcagctaccaggtggccaacggcatggagttcctggcctccaag
aactgtgtccaccgagatctggcagccagaaatgtgctcatctgtgagggcaagctggtc
aagatctgtgactttggcctggctcgtgacatcatgcgagactcgaactatatctccaaa
ggcagcaccttcctgcctctgaagtggatggctcccgagagcatcttcaacagcctctat
accaccctgagcgacgtgtggtccttcgggatcctactctgggagatcttcaccctgggt
ggcaccccttacccagagctgcccatgaacgaccagttctataacgccatcaagcgaggg
taccgcatggcccagcctgcccacgcctccgacgagatttacgagatcatgcagaagtgc
tgggaagagaagtttgagatccggcctcctttctcccagctggtgctgcttcttgagagg
ctgctgggcgagggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagc
gaccacccagccgtccttcggtcccaagcccgcttgcctggcttccatggcctccgatct
cccctggacaccagctctgtcctctacactgctgtgcagcccaacgagggtgacaacgac
tacatcatccccctgcctgaccccaaacctgaggttgctgatgagggcccactggagagt
tctcccagccttgccagctccaccctgaatgaggtcaacacctcctctaccatctcctgc
gacagccccctggagccccaagaggagcccgagccccagcccgagccccagggggagccg
gagccgccactggagtcaagctgccctgggcctcgggccgaggcagaggacagcttcctg
tag

KEGG   Ursus arctos horribilis: 113264675
Entry
113264675         CDS       T05909                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04066  HIF-1 signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113264675 (IFNGR2)
   04066 HIF-1 signaling pathway
    113264675 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113264675 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113264675 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113264675 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    113264675 (IFNGR2)
   04659 Th17 cell differentiation
    113264675 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113264675 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113264675 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113264675 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113264675 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113264675 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    113264675 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    113264675 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113264675 (IFNGR2)
   05140 Leishmaniasis
    113264675 (IFNGR2)
   05142 Chagas disease (American trypanosomiasis)
    113264675 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113264675 (IFNGR2)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IFN receptor family
   113264675 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 113264675
NCBI-ProteinID: XP_026367397
UniProt: A0A3Q7XVZ3
LinkDB
Position
Unknown
AA seq 353 aa
MRPPPPPLSLLSLLLLLLLGGRGAPALPADSRFQLPAPRNPKIRLYNNEQVLRWEPGSLS
NDTRPVVYQVQFTFLSGSRWYDTDDIGVNCMNVTKTECNFTPSSLSEGLPLFFNVSLRVR
AKAQDLVSPWLTVPWFLYYWNVTVGPPENVWVTPGEGSLIVRFSSPFDIPASKATFQYYV
HYWEKAGIQKVEGPFRSNSIVLNGLKPLREYCLQVRAHLIWTHYNISRPGHLSNVSCYET
TMDATTRLQQVIVIAVGIFLLLSALAGACFFLVLRYKGLVKYWFHSPPSIPSQIEEYLKD
PSQPILEALDKDTSPTDDAWDSVSVISFAEKDREAAPQSTLNPNSGPVCQPVG
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgcggcccccgccgccgccgctgtcgctgctgtcgctgctgctgctgctgctgctcggc
ggccgcggcgcccccgcgctcccggcagactctcgcttccagctgccagctcctcgaaac
ccgaagattcgcctgtacaacaacgagcaggttctgaggtgggagccggggtccctgagc
aatgacacaaggccggtggtctaccaggtgcagttcacattcctctctggcagtaggtgg
tacgacaccgacgacataggtgtgaactgtatgaacgtcaccaagacagagtgtaacttc
accccatccagcctctcagagggtttgccactgtttttcaacgtctctttacgcgtccga
gctaaggcgcaggacctggtttccccctggctgacggtgccttggttcctgtactattgg
aatgtgaccgttggacctcctgagaacgtctgggtgaccccaggagaaggttccctgatc
gtcaggttctcctctcccttcgacatccctgcctccaaggccacttttcagtattacgtc
cattactgggaaaaggcaggaatccaaaaggttgaaggtcctttcaggagcaactccatc
gtgttgaatggcttgaaacccttgagagaatactgtttacaagtgagggcacatctgatt
tggacgcactacaacatctcgaggcccggacatttaagcaacgtatcttgctacgaaaca
acaatggatgccactaccaggctgcaacaagtcatcgtgattgccgtgggcatctttctg
ttgctgtcggcgctggcgggggcctgtttctttctggtcctgagatacaaaggcctggta
aaatactggtttcactctccgccgagcatcccgtcacaaatcgaagagtatttaaaggac
ccgagccagcctatcttagaggccctggacaaggacacgtcaccaacggatgatgcctgg
gactctgtgtccgtcatttcgtttgcagagaaggatcgagaagctgctccccaaagcact
ttgaacccaaactctggtccggtctgccagcctgtgggatga

KEGG   Ursus arctos horribilis: 113264796
Entry
113264796         CDS       T05909                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113264796 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    113264796 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113264796 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113264796 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113264796 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    113264796 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    113264796 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113264796 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113264796 (IFNAR1)
  09172 Infectious disease: viral
   05162 Measles
    113264796 (IFNAR1)
   05164 Influenza A
    113264796 (IFNAR1)
   05161 Hepatitis B
    113264796 (IFNAR1)
   05160 Hepatitis C
    113264796 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    113264796 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113264796 (IFNAR1)
   05169 Epstein-Barr virus infection
    113264796 (IFNAR1)
   05165 Human papillomavirus infection
    113264796 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113264796 (IFNAR1)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IFN receptor family
   113264796 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 DUF5109 DUF4542
Other DBs
NCBI-GeneID: 113264796
NCBI-ProteinID: XP_026367568
UniProt: A0A3Q7X035
LinkDB
Position
Unknown
AA seq 579 aa
MLLEVTEDVTSSASGGPQTMFALLGATTLVLVAGVPWMLPAAAGGTNLKSPQNVEVYIVD
DTFILRWDGSSPSVRNVTFSADYQTLENDTWLKLPGCQSIANTKCNFSSLKLNIYEEIKL
RIRAEEGNNTSPWHYVDSFTLFGKAQIGPPKVHLEAEDKAIIINITPPGTKGRGMWSLDS
SSFTYSLEIWKNSSSGDRRTETVYPRDKIYKLSPETTYCLKVKARLLPRKIGVFSPVYCI
KTTVENKLPPPENIQVDAENRIYVLKWDYAYENVTFQAQWLHAYLKKIPGDNSDKWKQIP
NCENVRTTQCVFPKNTFRKGIYLIRVRASDGNTTSVWSNEEKFDTQFQITLLPPVIAMKS
TNDVSLRVYISATEEPENRAMNHPYPLTYEIVFWENTSNAERKIVDKRTDFTFPKLKPLT
AYCVKARALIQDEKWNKSSVFSDTVCEKTKPGNTSKTWLIAGVCAALLSIPVVVYVMKLL
CRCIGYVFFPSSKPPSAIDEYFSEQPLRNLLLFTSEEQTERCFIIENTNTIIAIEETHQT
DGEHKKYNSQTSQDSGNYSNEDESSESKLSEEFVHQETE
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgctgctcgaggtgaccgaggatgtgacttcctcggccagcggtggcccgcagacgatg
ttcgccctcctgggcgcgacgaccctggtgctggtcgctggggtcccgtggatgttgccc
gcagccgcaggaggaacaaatctaaagtctcctcaaaatgtagaggtctacatcgttgat
gatacctttatcctgagatgggacgggagcagtccatctgtcaggaatgtgactttttca
gcagattatcaaacacttgaaaatgatacttggttaaaattgcctggatgtcagtctatt
gccaataccaaatgcaacttttcttcactcaagctcaatatttacgaagaaattaagttg
cgaataagagcagaggagggaaacaacacttctccgtggcattatgttgactcattcacc
ctatttggaaaagctcaaattggtcccccaaaagtacatttagaagccgaagataaggca
ataataataaacatcaccccacctggaacaaaaggtcgtggcatgtggtctctggatagc
tcaagctttacctacagcttagagatctggaaaaactcttcaagtggagacagaaggact
gaaactgtttaccccagagataaaatttataaactctcaccagagaccacttactgttta
aaagttaaagcaagacttttgccgagaaaaattggtgtctttagtcctgtgtattgtata
aagaccacagttgaaaataaactgcctccaccagaaaatattcaagttgatgctgaaaat
cgcatctatgttcttaaatgggattacgcatatgaaaatgtgacttttcaagctcagtgg
ctccatgcctatttaaaaaagattcctggggacaattcagataaatggaaacaaatacca
aactgtgaaaatgtccgaactacgcagtgtgtctttcccaaaaatactttccgaaaagga
atttaccttatccgtgttcgagcatctgatggaaataccacatctgtttggtctaacgaa
gaaaaatttgatactcaattccaaattaccctgcttcctccagtcattgccatgaaatcc
actaacgatgtttccctgcgggtctatatcagcgccacagaagagcctgaaaacagggct
atgaaccatccttacccactaacttatgaaattgtattttgggaaaacacttcaaatgct
gagagaaaaattgtggataaaagaactgattttacttttccaaaattgaaaccactaact
gcatattgtgtcaaagccagagccctcattcaggatgaaaagtggaataaaagcagtgtt
ttcagtgacactgtgtgcgagaaaacaaaaccaggaaatacttccaaaacctggctcata
gccggagtgtgcgctgcgttactttccatcccggttgtcgtctatgtcatgaaacttctc
tgtagatgtatcggttatgtgttcttcccatcaagtaagcctccttccgctatagatgag
tatttctctgagcaaccactccggaatctcctccttttcacgtccgaggaacaaacggaa
aggtgttttatcattgaaaatacaaacactatcattgcaatagaagaaactcaccaaact
gatggagagcacaaaaaatacaattcccaaaccagtcaagattcgggaaactattctaat
gaagatgaaagcagtgaaagcaaattgagtgaagaattcgtgcaccaggaaaccgagtga

KEGG   Ursus arctos horribilis: 113264906
Entry
113264906         CDS       T05909                                 

Definition
(RefSeq) interferon alpha/beta receptor 1a-like isoform X1
  KO
K05135  interleukin 10 receptor beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04630  Jak-STAT signaling pathway
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113264906
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113264906
   04061 Viral protein interaction with cytokine and cytokine receptor
    113264906
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113264906
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113264906
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113264906
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113264906
   04090 CD molecules [BR:uah04090]
    113264906
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL10/28 receptor family
   113264906
CD molecules [BR:uah04090]
 Proteins
  113264906
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 DUF2207
Other DBs
NCBI-GeneID: 113264906
NCBI-ProteinID: XP_026367676
UniProt: A0A3Q7W3G9
LinkDB
Position
Unknown
AA seq 699 aa
MLWSQNASPIRPQHLYLVVYINLMFGVLSSLPDLSDKSCTFKVTLRNFRVILSWELKNHS
IVPDHYTLQYTVISIPDHMKTVEHCSNITATFCDLTDVWEVLSETYAVTVDGFRGNTTLV
TCFIDFFLATHISLEPPEFDIVDFTDHINVHVNFPPVMPKILDGKVLQFYLPLIIEEQSG
GIVKKHNPTLDENVTGNFTYVIDNLLPNTNYCVSVYFKHRNLEEIHRSPVKCTLLPPAQD
TGSSESAKIGGIITMFLIAAVFISTILILKRVGYICLRNDFPKVLNFHNMSSWVFPEMPP
LEAVAFVEVIHINRKKKVWNYSYDDESDSNDEAAAPLTNTALGMVPPPENVRMKSVNFKN
ILQWELPAFPKGNLTFTAQYQSYRKFQDMCTSTALTECDFSSLSKYGDHTLRVRAESADE
HSDWVNVTFCPVDDTMIGPPGIQVEALANSLHMRFLAPKIENEPETWTMRNIYNSWVYNM
QYWKNGSDEKWPMTCQYDFEVLRDLEPWTTYCVRVQGFLPDRNKTGEWSKPMCEPTADDE
TAPSWTVAVVLAASVCAAFLLLGCSALLWYLYQKTKHTFSPGNCLPQHLKEFLGRPHHST
LLLFSFPPSDENEVFDKLSVITQVSESSRQNPGDGCTPRAPSGQGSSELVPEEGAYSVGY
STPLLLSPTSEGHQSGKPPEQNPHLELSDSRTTSQQPKS
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgctttggagccagaatgcttccccgattagaccacagcatctgtatctcgtggtgtat
atcaacctcatgtttggtgtgttatcttcgttgcctgatttgtcagataaatcttgcact
ttcaaggtgacattacgcaatttccgggtcatcttatcatgggaattaaaaaaccattcg
attgtaccagatcactatacattacagtacacggtcataagtataccagaccacatgaag
actgtggagcactgttcaaatatcacagcaacattttgtgacctaacggatgtgtgggag
gtcctgtccgagacgtacgccgtcacagttgatggattcagagggaacacaacactggtc
acgtgtttcatcgatttcttcctggcaacacacatatccttggagccgccggaatttgat
atcgttgattttaccgaccacattaatgtccacgtgaattttccacccgtcatgcccaag
atactagatggcaaagtattacagttttacttaccactcatcatcgaagaacagtcaggg
gggattgtcaagaagcataaccccacactagatgaaaatgtcactggaaatttcacttac
gtcatcgacaacttacttccaaacacaaactactgtgtatctgtttattttaagcataga
aatctggaagaaatacatagatctccagtaaaatgcaccctccttccacctgcacaggac
acaggatcatcagaatctgccaagataggaggaataattactatgtttttaatagctgct
gtcttcataagcaccattctaatactgaaacgggttggttatatatgcttaagaaatgat
ttccccaaagttttgaattttcataacatgtcatcctgggtattccctgagatgccacca
ttggaagcagtggctttcgtggaggtgattcacattaacaggaagaagaaagtgtggaat
tacagttacgacgacgagagtgacagcaatgatgaagcagccgcccctctgacaaacaca
gcattaggaatggtgccacctcctgaaaacgtcagaatgaagtcagttaatttcaagaac
attctacagtgggagttgcctgcttttcccaaagggaatctgactttcacagctcagtac
caaagttacaggaaattccaagatatgtgcacaagcactgccttgacggaatgtgatttc
tcaagtctttccaagtatggtgatcacaccttgagagtcagggccgaatctgcagatgag
cattcagactgggtaaacgtcaccttctgtcctgtggatgacaccatgattggaccacct
gggatacaagtagaagcacttgctaattctttacatatgcgtttcttagcccctaaaatt
gagaatgaacctgaaacatggaccatgaggaatatttataactcatgggtttataatatg
caatattggaaaaatggttccgatgaaaagtggccgatgacctgtcaatatgactttgag
gtcctcagggatcttgagccgtggaccacgtactgtgttcgagttcaagggttccttccg
gatcggaacaaaaccggggaatggagcaagcccatgtgcgagccgacagccgacgatgag
acggccccgtcctggactgtcgccgtggtcctggcagcgtcggtgtgcgcggccttcctg
ctgctcggctgctcggccctgctgtggtatctgtaccagaagaccaagcacactttctcc
cctggtaactgcctgccacagcacctgaaagagtttttgggccgccctcatcacagtacg
cttctgctcttctccttcccgccctctgatgagaatgaagtctttgacaaactgagcgtc
attacacaagtctccgaaagcagccggcagaatcctggtgatggctgcacccccagggcc
ccgtctgggcaggggtcctccgagctggtccccgaggagggagcatactcagtggggtac
agcacccccctccttctctcgcctacctctgagggtcatcagagtgggaaaccacctgag
caaaacccacatctagaactctcagattccaggacaacatctcaacaaccaaagagctag

KEGG   Ursus arctos horribilis: 113267608
Entry
113267608         CDS       T05909                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X1
  KO
K05071  interleukin 4 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113267608 (IL4R)
   04151 PI3K-Akt signaling pathway
    113267608 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113267608 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113267608 (IL4R)
   04658 Th1 and Th2 cell differentiation
    113267608 (IL4R)
   04659 Th17 cell differentiation
    113267608 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113267608 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113267608 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113267608 (IL4R)
   04090 CD molecules [BR:uah04090]
    113267608 (IL4R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113267608 (IL4R)
CD molecules [BR:uah04090]
 Proteins
  113267608 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind IL2RB_N1
Other DBs
NCBI-GeneID: 113267608
NCBI-ProteinID: XP_026371433
UniProt: A0A3Q7WEF1
LinkDB
Position
Unknown
AA seq 811 aa
MGQLCSGLTFPVSCLILVCVAGSGSVKVLQEPSCFSDYVSTSVCQWEMDGPTNCSAELRL
SYQLDFMGSENRTCVPENQEGAVCACSMLMDDVVNADVYQLDLWAGKQRLWGGSFQPSKH
VKPRPPGNLTVHPNVSHTWLLMWTNPYPTQNHLYSELTYMVNISNENDPMDFKVYNVTYM
GPTLRVAASTLKSGASYSARVRAWAQSYNSLWSEWSPSTTWLNYYEPWEQHLPLGISISC
LVILAICLSCYVSIIRIKKGWWDQIPNPAHSPLVAIVIQDPQVSLWGKRSRGQESAKCPH
WKSCLTKLLPCLLEHGVDRDEESSKTARHAPFQPPGKAAWRPVEVSKTVLWPESISVVQC
VELFEAPVDSEEEEEVEEDKRSFCPSPEGSGGSFQEGREDIAARLTESLFLDLLGGETGG
FCPQALEEFCLPPAAGTEGSQGRWAEFPGAGPQETSPQGREQPVHPESTPPASPTQRPVS
PAFLEMPPVIADNPAYRSFGSLLGQSLAPGEADLEPELAERPGEEDAGIPSAPRPSEPPE
SWEQILRQSVLQHQAAPAPGPGPGSGYRDFAGALRQGNAPNAGVAGFGPSGEAGYKAFSS
LLPGTSGGEASHGEGGYKPFQSLTLGGPGAPIPISIPLFTFGLDVEPPRGPQDSLLAAST
PGHLGVEPVGKGGDSHKTLLAPEQATDAFRDDPAGSIVYSALTCHLCGHLKQWHGQEERG
QAQMVPSPCCGCCCGDRSLPLVSPLRAPDALPGGAPLEASLSPASLAPSGVSEEGKSSLS
FQPAPSNAQSSNQTPKRVAVLSTEPTCTSAS
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggggcagctttgctctgggctcacattccctgtgagctgcctgatcctggtatgcgtg
gcaggctccgggagtgttaaggtcctgcaggagcccagctgcttctccgactatgtcagc
acgtctgtctgtcagtgggagatggacggtcccaccaactgcagtgccgagctccgcctg
tcctaccagctggactttatggggtccgagaaccgcacgtgtgtccccgagaaccaagaa
ggtgcggtgtgcgcgtgcagtatgctgatggatgacgtggtcaatgcggacgtctatcag
ctggacctgtgggctgggaaacagcggctgtggggaggctccttccagcccagcaagcac
gtgaagcccaggccccccggaaacctcacggttcaccccaacgtctcccacacgtggctg
ctgatgtggacaaacccgtaccctacccagaatcacctgtactccgagctcacctacatg
gtcaacatttccaatgaaaacgaccccatggacttcaaagtctataacgtgacctacatg
gggcccaccctccgtgtggcggccagcaccctgaagtctggagcttcctacagcgcacga
gtgagggcttgggctcagagctacaacagcttgtggagtgagtggagccccagcaccacg
tggcttaactactacgagccctgggagcagcacctgccgcttggcatcagcatctcctgc
cttgtcatcctggccatctgcctgtcctgctacgtcagcatcatcaggattaagaaagga
tggtgggaccagattccgaacccagcccacagccccctagtggccatagtcatacaggac
ccacaggtgtcactgtgggggaagcggtcccgaggccaggaatccgctaagtgcccacac
tggaagagctgtcttacgaagctcctgccctgtttgctggagcacggcgtggacagggac
gaggagtcctccaagaccgccagacacgcgcctttccagcctcctggaaaagcagcctgg
cgccctgtggaggtgagcaagaccgtcctctggccagagagcatcagtgtggtgcagtgt
gtggagctctttgaggccccggtggacagtgaggaggaggaggaggtggaagaagataaa
agaagcttctgcccatcgcccgagggcagcgggggcagcttccaggagggcagggaagac
atcgcggcccggctgacggaaagcctcttcctggaccttctcgggggggagaccgggggc
ttttgcccacaggctctggaggagttctgccttcctcctgctgcaggaactgagggctcc
caggggcgctgggctgagttcccaggggcggggccgcaggagacgtcgccccagggccgg
gagcagcctgtgcaccccgagtccacccctccggcctctccgacccagcggccagtcagc
ccggctttcctggagatgccccccgtcatcgcagacaaccccgcgtaccgcagcttcggc
agcctcctgggccagtccctagcccccggggaggctgacttggagccagagctggccgaa
cgccccggggaagaagacgccggcatcccctccgccccccggccctcggagccaccggag
agctgggagcagatcctgcgtcagagtgtcctccagcaccaggcggccccggcccctggc
cccggccccggcagcggctaccgggactttgcaggcgctctgaggcagggcaacgccccc
aacgccggggtggcgggcttcggcccttccggggaagcggggtacaaggccttctccagc
ctgctcccagggacatctgggggcgaggccagccatggggaggggggctacaaacccttc
cagagcctcactctaggcggccctggggcccccatccccatctctatccccctgttcacc
tttggactggatgtggagccaccgcgcggccctcaggactcgcttctcgcagccagcacc
ccagggcacctgggtgtggagccagtggggaagggaggggacagccacaagaccctgctg
gccccagagcaggccacagatgccttcagggacgacccggctggcagcatcgtctactcg
gccctcacctgccacctgtgcggccacctgaagcagtggcacggacaggaggagcgtggc
caggcccaaatggtgcccagcccctgctgtggctgctgctgcggggacaggtccttgccc
ctggtgagccccctgagggccccagacgccctgccgggtggggctccgctggaggccagc
ctctctccagcctccctggcaccctcgggagtctcagaggagggcaagtcctccctgtcc
ttccagcctgcccccagcaatgcgcagagctcaaaccagacccccaaaagggtggccgtg
ctctccacagagcccacgtgcacgagcgcttcttag

KEGG   Ursus arctos horribilis: 113267611
Entry
113267611         CDS       T05909                                 

Gene name
IL21R
Definition
(RefSeq) interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113267611 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113267611 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113267611 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113267611 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113267611 (IL21R)
   04090 CD molecules [BR:uah04090]
    113267611 (IL21R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113267611 (IL21R)
CD molecules [BR:uah04090]
 Proteins
  113267611 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 113267611
NCBI-ProteinID: XP_026371439
UniProt: A0A3Q7X2F5
LinkDB
Position
Unknown
AA seq 545 aa
MLCGSVASLFLLMLQWAWGCRDLVCYTDYFQTVTCTLETRTLHPGMLTLTWQDPYGELED
EVTSCSLHRSAHNATHAKYTCHMDVFRFMADDIFSVNVTDQSGSYSQECGSFVLADSIKP
SPPFNVTVTMNFSGHYNISWSSNYDSYALKGKLQFELRYRKWGGPWALSPGRKLISVDSR
SVSLLPLEFQSDSSYELQIRAGPQAGSSFQGTWSEWSDPVIFHTQPEEIKGGWRTYLLYL
LLVIILPILVFLGLKIHLPWRLWKKVWGQVPSPQKFFQPLYVGHSGDFKKWVGAPFTASS
LELGPRSPEVLSSLQTHTCCPPRSATKGLQPTQLLESTDLVEADGLPELGFWGLAPFTAG
SLGGSAYSQERDRPYGVVLSIDTVTVADTEGPCAWSCTCGDDGYPALNLDASLEPSSGAE
DPLLDTGTTVLSCGCVSTGGLAGLGGPPGSLLDGLKLPLEDEAGWTPGPPWSGGPPRGAS
DSEAGSPPAGLDMDTFDSGFAGSDCGSPVECDFTSPSDEGPPRSYLRQWVVMAPPPEGPG
PQASQ
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgttgtgtggctcggtggcctctctcttcctgctgatgctccagtgggcctgggggtgc
cgagacctcgtctgctacaccgattacttccaaacagtcacctgcaccctggagacaagg
accctccacccgggcatgctcaccctcacctggcaagacccatatggagaactggaggac
gaggtcacctcctgcagcctccaccggtccgcccacaacgccacgcatgccaagtacaca
tgccacatggatgtgtttcgattcatggccgacgacattttcagcgtcaatgtcacggac
cagtccggaagttactcccaggagtgtggcagcttcgtcctggccgacagcatcaagccg
tccccccctttcaacgtgaccgtgaccatgaacttctcaggacattataacatctcctgg
agctccaattacgattcctacgcgctgaagggcaagctgcagtttgagctgcgatacagg
aagtggggaggcccctgggctctgagtccggggagaaagctgatctcggtggattcgaga
agcgtctctctccttcccttggagttccagagcgactcgagctatgagctgcagatacgc
gcagggccccaggccggctcgtccttccaggggacctggagtgagtggagtgacccagtc
atctttcacacccagccggaagagataaagggaggctggcgtacttacctgctgtatctc
ctcctggtcatcatactccccatcctcgtcttcttaggcctgaagatccacctgccttgg
aggctgtggaagaaggtgtggggacaggtgcccagcccacagaagttcttccagcccctc
tacgtgggccacagtggagacttcaagaaatgggtgggtgcacccttcactgcctccagc
ctggagctgggaccccggagccccgaggtgctctcttccctgcagacacacacctgctgc
cctccgcggagcgccaccaaggggctgcagcccacgcagctgctggagtccactgacctg
gtggaagctgatgggctgcctgagctgggcttctggggcctggcccccttcactgctggc
agcttgggtggctcggcttacagccaggagagggaccgaccatatggcgtcgtactctcc
attgacacggtgaccgtagcagacacagaggggccgtgtgcctggtcctgcacctgtggg
gatgatggctacccagccctgaacttggacgccagcctggagcccagctcaggcgccgag
gacccgctcttggacaccgggactacggtcctctcctgtggctgcgtctcgactggtggc
cttgccgggctgggaggccctcctggcagcctcctcgacggactaaagctgccccttgaa
gatgaggcaggttggaccccggggccgccgtggagtggcgggccccccagaggggcgtcg
gacagcgaagcgggctcgcctcccgccggcctggacatggacacttttgacagcggcttc
gcgggctctgactgcggcagccccgtggagtgtgacttcaccagccccagtgacgaaggg
ccccccaggagctacctccgccagtgggtggtcatggcccctccccctgagggcccaggg
ccccaggccagccagtga

KEGG   Ursus arctos horribilis: 113268222
Entry
113268222         CDS       T05909                                 

Gene name
IFNLR1
Definition
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113268222 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268222 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113268222 (IFNLR1)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL10/28 receptor family
   113268222 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Chromate_transp Ribosomal_60s
Other DBs
NCBI-GeneID: 113268222
NCBI-ProteinID: XP_026372330
UniProt: A0A3Q7X4U3
LinkDB
Position
Unknown
AA seq 569 aa
PPARSSASHWLPAAATCGPVSPEVGGGTRPYRAGSAGAGLAGVGRWVPLLLCLLQSTLGK
PRLAPPRNVTLLSRNFSVYLTWLPGPGYSQNVTYFVAYQSAPTPRRWRKVKKCAGTKDLA
CSLMCLEKQDLYNKFKGRVWAVSPSARSPSVESKYLDYLFEVEPAPPVLVVTRTEEILSI
NATYQLPHCMPPPDLKYEVDFWKEGIRNKTRFPVTPRGQPVHIPLQPAASGHYCLSARTI
YTFGDPKYSEFSKPTCFFLEAPGAPWVFLVLLPLLLPLLLVIAIGYVIWKSFRENPWFQR
AKTPRALDFSGCRYPVATFQPSDPECPDTLILCPQKELTRRVRPSPGVRTPATVQAGSEK
NNAEKEEEDEDEDEDTDDNISFQPYLEPPPFLGQEHKIPGHSEAGGTCSPPVQVEGSSAT
DASDRSWASTGGSSPWDEPGSSCYLAKKTLGQGPGGDGCQEPLPLPEFSKDVSFPEDALK
DDLSSWASWGSTSPGLKLVPGEPPVSLHTLTFCWDSSPEEEEEEEEEGGEGWGRGREAET
EDDSPGNWGAGSLRKTEVGGGTLGHYMAR
NT seq 1710 nt   +upstreamnt  +downstreamnt
cccccggcccgtagctcggcctcccattggctgccggcagcggcaacctgtgggccggtg
agcccggaggtgggaggtgggacccggccgtaccgggcgggcagcgctggagccggcctg
gcgggggtcgggcggtgggtccccctactgctgtgcctgctgcagtctactctagggaag
ccccgtctggcccctccccggaacgtgaccctgctctcccggaacttcagtgtgtacctg
acatggctcccagggcctggctactcccagaatgtgacctattttgtggcctatcaaagc
gctccgacccccagacggtggcgaaaagtgaagaagtgtgcaggaaccaaagacctggca
tgttctttgatgtgcctggagaaacaagacctgtacaacaagttcaagggccgtgtatgg
gcggtttctcccagcgccaggtccccctcggtggagtccaagtacctggattaccttttt
gaagtggagccagccccacccgtcctggtggtcactcggacagaggagattctgagcatc
aatgccacctaccagctgccccactgcatgcccccaccggatctgaagtatgaggtggat
ttttggaaggagggaatccggaacaagacgcgatttcccgtcactccccgcggccagcca
gtccacatccccctgcagccagccgccagtggacactattgcctcagtgccagaaccatc
tacaccttcggggatcctaaatacagcgagttctccaagcctacctgcttcttcctggag
gccccaggagccccctgggtattcctggtgctgctaccacttctgcttcccctgctgttg
gtcattgccataggctatgtgatctggaagagcttcagagagaacccctggtttcagcgg
gcgaagacgccgagggccctggacttttctggatgcagataccccgtggcaacctttcag
cccagtgaccccgagtgcccagatacgttgatcctctgtccacaaaaggaactgaccaga
agggtcaggccaagccctggagtcaggaccccagccactgtccaggcaggatcagagaag
aacaatgctgagaaggaggaggaggacgaggacgaggacgaggacacagatgacaacatc
agctttcagccctaccttgaaccaccccccttcctagggcaggagcacaagatcccgggg
cactctgaggcaggcggcacctgtagtcctcctgtccaggtcgaaggctcctctgctacg
gatgcttcagacagaagctgggccagcacggggggctcctccccctgggatgagcctggg
tcctcttgctatctggccaagaagacgctaggccaagggccgggtggggatgggtgtcag
gagcctctcccactgcctgaattctccaaggatgtaagtttcccggaagatgccctgaaa
gatgacctctcctcctgggccagctggggctctacatcaccagggctgaaactggtccct
ggagagcccccagtttctcttcacacactgaccttttgctgggacagcagccctgaagag
gaagaggaggaggaggaggaaggaggagaaggatggggaagagggagggaagcagaaact
gaggatgacagtcctggcaattggggggctgggagcctgcggaagactgaggtcggaggt
gggacactgggacattacatggccaggtga

KEGG   Ursus arctos horribilis: 113268281
Entry
113268281         CDS       T05909                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113268281 (CSF3R)
   04151 PI3K-Akt signaling pathway
    113268281 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268281 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113268281 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113268281 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113268281 (CSF3R)
   04090 CD molecules [BR:uah04090]
    113268281 (CSF3R)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  Prolactin receptor family
   113268281 (CSF3R)
CD molecules [BR:uah04090]
 Proteins
  113268281 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind ObR_Ig Tissue_fac fn3_2
Other DBs
NCBI-GeneID: 113268281
NCBI-ProteinID: XP_026372428
UniProt: A0A3Q7X533
LinkDB
Position
Unknown
AA seq 838 aa
MAGLGTWSLTVAALIILLLPRSLEECGRISLPTPIVHLGDPITASCTISPNCSHLDPESQ
ILWKLGTELQPGKRQRLADGRQEFTITVAHLNSPRVLLSCCLRWGTSLQILDQAEVQAGY
PPAAPHNLSCLMNLTTNSLICQWEPGPNNHLSTNFTLKSFKSRGNCQTQEDSIPDCVPND
GQNHCSIPRRHLQLYQNMGIWVQAENALGTSKSPQLCLVPMDVVKLEPPTLWALDPSPEV
APPQPGCLLLRWEPWRPSLYIEQKCELRHQPQPGEASWALVGPLLSQTLQYELCGLLPST
AYALQLRCTRWPLPGHWSDWSPSLTLTTAQQAPIVRLDTWWRQRQLDPRTADVQLFWKPT
PLDKYSGQIQGYLVRAPDQAETVPPLCNTTELSCTFHLPLEAREVVLVAYNTAGTSHPTP
VVFLESRGPPLARLHTVARDPYSLWVGWEPPSPRPQGYVIEWGLGPPSPSGSNKSWKMEH
NGSMSGTLLQENIRPFQLYEITVTPLYQDTVGPSQHIYAYSQEMAPSHAPELHLKHIGKT
WAQLEWAPQAPELGKSPLTHYTVFWTNAQDQSFSTVLNASSHGLVLHGLEPASLYHVHLM
ATSRVGAANSTSLTLMTLALEESELHVLLGLFAFLLLFTCLCGAARFCCRPSRKNPLWPS
VPDPAHSSLGSWVPTIMVEETFQLPSLRDPGMPPITKITVLEEEEKKPVPWESNDSSGSC
GLPTLVQAYVLQGDPRVPSTQPQPPSITSDQVLYGKVLGSPTSPGPGHYLRCDSTQPLLG
GLSPSPKFYENLWFQTSPLGTPEPLVPNQEDDCVFGPLLDFPLLQGLQVHGVEGLGGV
NT seq 2517 nt   +upstreamnt  +downstreamnt
atggcagggctgggaacctggagcctgaccgtggccgccctgattatcctgctgctcccc
agaagcctggaggagtgcgggcgcatcagcctcccaacccccattgtccacctgggggat
cccatcacagcttcctgcaccatcagcccgaactgcagccacctggaccccgagtcccag
attctgtggaaactgggaacggagcttcaacccggaaagaggcagcgtctggcggatgga
aggcaggaattcaccatcactgtggcccatctcaacagccctcgggtccttctctcctgc
tgcctgcgctggggcaccagcctgcagatcctggaccaggctgaggtgcaggccggctac
cctcccgccgcaccccacaacctgtcctgtctcatgaacctcacaaccaacagcctcatc
tgtcagtgggagccaggacccaacaaccacctgtccaccaacttcaccctcaagagcttc
aagagtcgcggcaactgtcagacccaagaggactctatccccgactgcgtgcctaacgat
gggcagaaccactgctccatcccacggagacacctgcagctgtaccagaacatgggcatc
tgggtgcaggccgagaatgcgctagggaccagcaagtccccacagctgtgcctcgttccc
atggatgtcgtgaagctggagccccccaccctgtgggccctggaccccagtcctgaggtg
gccccaccccagccaggctgcctgctattgcgctgggagccatggaggccaagcctgtac
atagaacagaaatgtgagctacgccaccagccacagcctggagaagccagctgggccctg
gtgggccccctgctgtcgcagaccctccagtatgagctctgcgggctcctcccatccaca
gcctacgccctgcagctgcgttgcacccgctggcccctgcctggccactggagcgactgg
agccctagcctgacgctgaccactgcgcaacaggcccccatcgtcagactggacacatgg
tggcggcagagacagctggaccccaggacggcggatgtgcagctgttctggaagccaacg
cccttggacaaatacagcggacagatccaaggctacctggtcagagctccagaccaggct
gagacagtccccccactctgcaacaccacggagctaagctgcaccttccatttgcccttg
gaagcccgggaggtggtccttgtggcctataacacagccgggacctctcatcccacccca
gtggtcttcctggagagcagaggtccgcccctggccagactccacaccgtggctcgagat
ccctacagcctctgggtgggctgggagccccccagccctcggcctcagggctatgtgatt
gagtggggtctgggtccccccagccccagcggcagcaataagagctggaagatggagcat
aatggaagcatgtctgggacgctgctgcaggagaacatcaggccctttcagctctatgag
atcactgtgacccccctctaccaggacaccgtgggaccctcccagcacatctatgcctac
tcccaagagatggccccctcccacgccccagagctgcacctaaagcacattggcaagacc
tgggcccagctggagtgggcgccccaggcccccgagctggggaagagccccctcacccac
tacaccgtcttctggaccaatgctcaggaccagtccttctccactgtcctgaatgcctcc
tcccatggcttggtcctccacggcctggagcctgccagcttgtaccatgttcacctcatg
gctaccagcagggtcggggccgccaacagtacaagcctcaccctgatgaccttggcccta
gaggagtctgagctgcatgtcctcctgggcctgtttgccttcctgctcttgttcacctgc
ctctgtggggctgcccggttctgctgcagacccagcaggaagaatcccctgtggccaagt
gtcccagacccagcccatagcagcctgggctcctgggtgcctaccatcatggtggaggag
accttccagctgcctagccttcgggaccccggcatgccacccatcaccaagatcacagtg
ctggaggaagaagagaagaagccagtgccctgggagtccaatgacagctcagggtcctgt
ggcctccccaccctggtccaggcctatgtgctccagggggacccaagagtaccttccacc
cagccccagcccccgtctatcaccagtgaccaggtcctttatgggaaggtgctgggcagc
cccacaagcccaggtccggggcactatctccgctgtgactctactcagcccctcttaggg
ggcctttctcccagccccaagttttatgagaacctctggttccagaccagccccctgggc
accccagagcccctggtcccaaaccaggaggatgattgtgtcttcgggccactgcttgac
ttccccctcctgcaagggctccaggtccacggggtagaggggctggggggcgtctag

KEGG   Ursus arctos horribilis: 113268505
Entry
113268505         CDS       T05909                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113268505 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113268505 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113268505 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113268505 (IL22RA1)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL10/28 receptor family
   113268505 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 113268505
NCBI-ProteinID: XP_026372833
UniProt: A0A3Q7XED3
LinkDB
Position
Unknown
AA seq 579 aa
MRTLLTILAAGSLAAHMVEDTSNLLQHVKFQSSNFENILTWDSGLESAPDTVYSVEYKRY
GEREWLAKEGCQRVTRKSCNLTMETGNLTELYYARVTATSAGGRSATKMTDRFSSLQHTT
IKPPDVTCIPKVRSIQMIVHPTSTPIRAGDGHQLTLEDIFPDLFYRLELQVNHTYQMHLG
GKQRDYEFIGLSPDTEFLGTIMIFVPTWSKESAPYVCRVKTLPDRTWTYSFSGAFLFSAG
FLVAGLCYLSYRYVTKPPPPPDSLNVQRVLTFQPLRFIQEHVLIPVFDLSSPSSLAQPVQ
YSQVKVSGPREPPGAPPLHSLSEITYLGQTDIPILRPSGVPAHQTLSPQSYAPQAAPEVR
PPSYAPQVTPEAKTPFYTAQAMSEVQPPSYTPQTTPACWPSYGTCGEGSGEDSPPVTLSS
PKHLRTKGLQKKAPAGTYIPDGLSLQGVTSLDMEDPQEENFFHQPPGVHADRVPEPSVLH
GGDPGTPLYLKGQLPLLSSVQIEGHPVSLPLHTPSLPCSPTDQEPSPWGLLESLMCPKDE
GPVPEMGAQSPGSQASDLEQPTELDSLFRGLALTVQWEA
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgaggacactactgaccatcctagccgcgggatccctggccgctcacatggtggaggac
acctcgaatctgcttcagcacgtaaaattccagtccagtaacttcgaaaacatcctgacg
tgggacagcgggctggagagcgccccggacacggtctacagcgtggagtataaaaggtac
ggagagagagagtggctggcgaaggagggctgccagagggtcacccggaaatcctgcaac
ctgaccatggagacgggcaacctcacggagctctactacgcccgggtaactgccaccagc
gcgggaggccggtcagccaccaagatgaccgatcggttcagctcgctgcaacacactacc
atcaaaccacccgacgtgacctgtatccccaaggtgagatccatccagatgatcgtccat
cccacctccacgcctatccgcgctggggatggccaccagttaaccctggaggacatcttc
cctgacctattctaccgcttagagctccaggtcaaccacacctaccaaatgcaccttgga
gggaagcagagagactacgagttcattggcctgtcgcctgacacagagttccttgggacc
atcatgatttttgttccaacctggtccaaagagagtgctccctacgtgtgccgagtaaag
accctgccagatcggacgtggacgtactccttctcaggcgccttcctgttctccgcgggc
ttcctcgtcgcggggctctgctacctgagctacagatacgtcaccaaaccgcctccacct
cccgactccctgaacgtccagcgagtactgaccttccagcctctgcggttcatccaggag
cacgtgctgatccctgtctttgacctgagcagccccagcagtctggcccagcccgtccag
tactcccaagtcaaggtctccgggcccagggagcccccaggagccccgccactgcacagc
ctgtctgaaatcacctatctcgggcagacagacatccccatcctccggccctctggagtg
ccagctcaccagacgctctccccacagtcctacgcaccccaggccgcccccgaagtcagg
cccccttcctatgcaccgcaagtaacccccgaagccaaaactccattctacactgcacag
gccatgtccgaggtccagcctccctcctacacccctcagaccactccagcctgctggcct
tcctatgggacctgcggggaaggctctggcgaagactccccacctgtaacactctccagt
cccaaacacctcaggactaaagggctccagaaaaaggcaccagctggaacttatatccca
gatggcctttctctgcaaggggtgacctccttggatatggaggacccccaagaagaaaat
ttcttccaccagcctccgggagttcacgcggacagagtgcctgaacccagtgtgctacac
ggaggggacccagggacaccattgtacctaaagggccagcttcccctcctctcctctgtc
cagatcgagggccacccggtatccctccctttgcacactccttccctcccatgttccccc
acagaccaggaaccaagtccctggggcctgctggagtccctcatgtgtcccaaggacgag
ggtcccgtgcctgagatgggggcccagagcccaggctctcaggcctcagacctggagcag
cccacagaactggactctctcttcagaggcctggccctgactgtgcagtgggaggcctga

KEGG   Ursus arctos horribilis: 113270253
Entry
113270253         CDS       T05909                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-9 receptor-like
  KO
K05073  interleukin 9 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113270253
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113270253
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113270253
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113270253
   04090 CD molecules [BR:uah04090]
    113270253
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113270253
CD molecules [BR:uah04090]
 Proteins
  113270253
SSDB
Other DBs
NCBI-GeneID: 113270253
NCBI-ProteinID: XP_026375173
UniProt: A0A3Q7XKT3
LinkDB
Position
Unknown
AA seq 367 aa
MWAPAESHLDGRGGHVPVKRTSRVGHLDPPSGXQSNVSSDCLVVTWSVSPVLEPLTSVLS
RELAFKKQEEAWEQARHRDHIVGVTRLTLEAVELDPGSRCEARLRVQKATLEDDMMEELH
CEGQWREWSQSACFPTPQSPSEGTPAGLCHVDLEERPGAREAHNSGPFLPTGSLISPWGQ
PDSSTLVAVPTFLLLTSLTYLVFKLSPRVRRSFSQNVPSPVAFFPSLCSVHNGDFQTWLG
AHRTGLLLSQDCTGSPRGASESSVREAVAWLTXDPVDLWQSVVLEEEWEGPGGGLPEAIA
AVVTTGPCAAPGGWHPSTFPENTRSSGPSPALACDLSWDQQSLHAWQGSGPVGVGHSERQ
VPAARIP
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtgggcgccagcggagagtcacttggatggcaggggtggtcacgtgcccgtcaagcgc
acatcacgtgtgggtcacttggaccctccctctggctgacagagcaatgtcagctctgac
tgtcttgtcgtgacctggagcgtcagtcctgtcctggagcccctgacctccgtcctcagc
cgcgagctggccttcaagaagcaggaagaggcctgggagcaggcccggcacagggatcac
atcgttggggtgacccggctcaccctcgaagctgtcgaactggaccccggttcccgctgt
gaggcccggctgcgggtccagaaggccaccctggaggatgacatgatggaggagctgcac
tgtgagggccagtggagggaatggagccagtctgcctgcttccccactccccagagccct
tctgagggcactcctgcggggctttgccatgtggatttggaagaacgtcctggtgccagg
gaggctcacaactctgggcccttcctgcccacaggctccctgatctcaccttgggggcag
cccgacagcagcacccttgtggctgtgcccacctttctgctgctgaccagcctgacctat
cttgtgttcaagctttcgcccagagtgaggagaagcttctcccagaacgtgccctctcca
gtggcgttcttcccgtccctctgcagtgtgcacaacggggacttccagacctggctaggg
gcccacagaacgggtctgctgctgagccaggactgcaccggctccccacgaggagcctca
gagtctagtgtccgggaggccgttgcgtggctgacctaggacccagtggatctctggcag
tcagtggtcctggaggaagagtgggagggccctggaggtggcctcccagaggctattgca
gcagtggtgactactgggccctgtgctgccccgggggggtggcacccctccaccttccca
gaaaacacacggagctctgggcccagcccagctttggcctgtgacctttcttgggaccag
cagagcctgcatgcctggcaaggaagtggtcctgtgggagtcggtcacagtgagaggcag
gtccccgctgcacggatcccatga

DBGET integrated database retrieval system