KEGG   Ursus arctos horribilis: 113240885
Entry
113240885         CDS       T05909                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04114  Oocyte meiosis
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04218  Cellular senescence
uah04270  Vascular smooth muscle contraction
uah04370  VEGF signaling pathway
uah04371  Apelin signaling pathway
uah04380  Osteoclast differentiation
uah04510  Focal adhesion
uah04540  Gap junction
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04620  Toll-like receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04666  Fc gamma R-mediated phagocytosis
uah04668  TNF signaling pathway
uah04720  Long-term potentiation
uah04722  Neurotrophin signaling pathway
uah04725  Cholinergic synapse
uah04726  Serotonergic synapse
uah04730  Long-term depression
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04916  Melanogenesis
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04921  Oxytocin signaling pathway
uah04926  Relaxin signaling pathway
uah04928  Parathyroid hormone synthesis, secretion and action
uah04929  GnRH secretion
uah04934  Cushing syndrome
uah04935  Growth hormone synthesis, secretion and action
uah05010  Alzheimer disease
uah05020  Prion diseases
uah05034  Alcoholism
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05212  Pancreatic cancer
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05216  Thyroid cancer
uah05218  Melanoma
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113240885 (MAP2K1)
   04015 Rap1 signaling pathway
    113240885 (MAP2K1)
   04010 MAPK signaling pathway
    113240885 (MAP2K1)
   04012 ErbB signaling pathway
    113240885 (MAP2K1)
   04370 VEGF signaling pathway
    113240885 (MAP2K1)
   04371 Apelin signaling pathway
    113240885 (MAP2K1)
   04668 TNF signaling pathway
    113240885 (MAP2K1)
   04066 HIF-1 signaling pathway
    113240885 (MAP2K1)
   04068 FoxO signaling pathway
    113240885 (MAP2K1)
   04072 Phospholipase D signaling pathway
    113240885 (MAP2K1)
   04071 Sphingolipid signaling pathway
    113240885 (MAP2K1)
   04024 cAMP signaling pathway
    113240885 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    113240885 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    113240885 (MAP2K1)
   04150 mTOR signaling pathway
    113240885 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113240885 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    113240885 (MAP2K1)
   04210 Apoptosis
    113240885 (MAP2K1)
   04218 Cellular senescence
    113240885 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113240885 (MAP2K1)
   04540 Gap junction
    113240885 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    113240885 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113240885 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113240885 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    113240885 (MAP2K1)
   04660 T cell receptor signaling pathway
    113240885 (MAP2K1)
   04662 B cell receptor signaling pathway
    113240885 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    113240885 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    113240885 (MAP2K1)
   04062 Chemokine signaling pathway
    113240885 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113240885 (MAP2K1)
   04929 GnRH secretion
    113240885 (MAP2K1)
   04912 GnRH signaling pathway
    113240885 (MAP2K1)
   04915 Estrogen signaling pathway
    113240885 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    113240885 (MAP2K1)
   04917 Prolactin signaling pathway
    113240885 (MAP2K1)
   04921 Oxytocin signaling pathway
    113240885 (MAP2K1)
   04926 Relaxin signaling pathway
    113240885 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    113240885 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    113240885 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    113240885 (MAP2K1)
   04916 Melanogenesis
    113240885 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113240885 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    113240885 (MAP2K1)
   04726 Serotonergic synapse
    113240885 (MAP2K1)
   04720 Long-term potentiation
    113240885 (MAP2K1)
   04730 Long-term depression
    113240885 (MAP2K1)
   04722 Neurotrophin signaling pathway
    113240885 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113240885 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113240885 (MAP2K1)
   05206 MicroRNAs in cancer
    113240885 (MAP2K1)
   05205 Proteoglycans in cancer
    113240885 (MAP2K1)
   05230 Central carbon metabolism in cancer
    113240885 (MAP2K1)
   05231 Choline metabolism in cancer
    113240885 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113240885 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113240885 (MAP2K1)
   05212 Pancreatic cancer
    113240885 (MAP2K1)
   05225 Hepatocellular carcinoma
    113240885 (MAP2K1)
   05226 Gastric cancer
    113240885 (MAP2K1)
   05214 Glioma
    113240885 (MAP2K1)
   05216 Thyroid cancer
    113240885 (MAP2K1)
   05221 Acute myeloid leukemia
    113240885 (MAP2K1)
   05220 Chronic myeloid leukemia
    113240885 (MAP2K1)
   05218 Melanoma
    113240885 (MAP2K1)
   05211 Renal cell carcinoma
    113240885 (MAP2K1)
   05219 Bladder cancer
    113240885 (MAP2K1)
   05215 Prostate cancer
    113240885 (MAP2K1)
   05213 Endometrial cancer
    113240885 (MAP2K1)
   05224 Breast cancer
    113240885 (MAP2K1)
   05223 Non-small cell lung cancer
    113240885 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113240885 (MAP2K1)
   05020 Prion diseases
    113240885 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    113240885 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113240885 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113240885 (MAP2K1)
   05135 Yersinia infection
    113240885 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113240885 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    113240885 (MAP2K1)
   05164 Influenza A
    113240885 (MAP2K1)
   05161 Hepatitis B
    113240885 (MAP2K1)
   05160 Hepatitis C
    113240885 (MAP2K1)
   05163 Human cytomegalovirus infection
    113240885 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113240885 (MAP2K1)
   05165 Human papillomavirus infection
    113240885 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113240885 (MAP2K1)
   01522 Endocrine resistance
    113240885 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113240885 (MAP2K1)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     113240885 (MAP2K1)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: STE group
  STE7 family
   113240885 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 113240885
NCBI-ProteinID: XP_026334140
UniProt: A0A3Q7U1P7
LinkDB
Position
Unknown
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDGEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggccttgcagaagaagctggaggagctg
gagctcgatgagcagcagcggaagcgcctggaggccttcctcacccagaagcagaaggtc
ggggaattgaaggatgacgactttgagaagatcagtgagctgggcgctggcaacggtggt
gtggtgttcaaggtctcccacaagccctctggcctggtcatggccagaaagctaattcac
ctggagatcaaacctgcaatccggaatcagatcataagagagctgcaggttctgcatgag
tgcaactcgccttacatcgtgggcttctatggtgcgttctacagcgatggcgagatcagt
atctgcatggaacatatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggtctgacttacctg
agggagaagcacaagattatgcacagagatgtcaagccttccaacatcctcgtgaactcc
cgtggggagatcaagctctgtgactttggggtcagtgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggtggggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaagtggag
ggagatgcggctgagacgccacccagaccaaggacccccggaaggcccctcagctcttac
ggaatggacagccggcctcccatggcgatttttgagttgctggattacatagtcaatgag
cctcctccaaaactgcccagtggagttttcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccccgcagagagagcagatctgaagcaactcatggttcatgccttc
atcaagagatcggacggggaagaagtggattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacaccgacccacgcagccggcgtctaa

KEGG   Ursus arctos horribilis: 113242822
Entry
113242822         CDS       T05909                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04015  Rap1 signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04218  Cellular senescence
uah04270  Vascular smooth muscle contraction
uah04370  VEGF signaling pathway
uah04371  Apelin signaling pathway
uah04540  Gap junction
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04620  Toll-like receptor signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04720  Long-term potentiation
uah04722  Neurotrophin signaling pathway
uah04730  Long-term depression
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04915  Estrogen signaling pathway
uah04916  Melanogenesis
uah04917  Prolactin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah04921  Oxytocin signaling pathway
uah04926  Relaxin signaling pathway
uah04929  GnRH secretion
uah04934  Cushing syndrome
uah04935  Growth hormone synthesis, secretion and action
uah05010  Alzheimer disease
uah05020  Prion diseases
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05216  Thyroid cancer
uah05218  Melanoma
uah05219  Bladder cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05230  Central carbon metabolism in cancer
uah05231  Choline metabolism in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113242822 (MAP2K2)
   04015 Rap1 signaling pathway
    113242822 (MAP2K2)
   04010 MAPK signaling pathway
    113242822 (MAP2K2)
   04012 ErbB signaling pathway
    113242822 (MAP2K2)
   04370 VEGF signaling pathway
    113242822 (MAP2K2)
   04371 Apelin signaling pathway
    113242822 (MAP2K2)
   04066 HIF-1 signaling pathway
    113242822 (MAP2K2)
   04068 FoxO signaling pathway
    113242822 (MAP2K2)
   04072 Phospholipase D signaling pathway
    113242822 (MAP2K2)
   04071 Sphingolipid signaling pathway
    113242822 (MAP2K2)
   04024 cAMP signaling pathway
    113242822 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    113242822 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    113242822 (MAP2K2)
   04150 mTOR signaling pathway
    113242822 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113242822 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    113242822 (MAP2K2)
   04218 Cellular senescence
    113242822 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113242822 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    113242822 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113242822 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113242822 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    113242822 (MAP2K2)
   04660 T cell receptor signaling pathway
    113242822 (MAP2K2)
   04662 B cell receptor signaling pathway
    113242822 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    113242822 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113242822 (MAP2K2)
   04929 GnRH secretion
    113242822 (MAP2K2)
   04912 GnRH signaling pathway
    113242822 (MAP2K2)
   04915 Estrogen signaling pathway
    113242822 (MAP2K2)
   04917 Prolactin signaling pathway
    113242822 (MAP2K2)
   04921 Oxytocin signaling pathway
    113242822 (MAP2K2)
   04926 Relaxin signaling pathway
    113242822 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    113242822 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    113242822 (MAP2K2)
   04916 Melanogenesis
    113242822 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113242822 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    113242822 (MAP2K2)
   04730 Long-term depression
    113242822 (MAP2K2)
   04722 Neurotrophin signaling pathway
    113242822 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113242822 (MAP2K2)
   05206 MicroRNAs in cancer
    113242822 (MAP2K2)
   05205 Proteoglycans in cancer
    113242822 (MAP2K2)
   05230 Central carbon metabolism in cancer
    113242822 (MAP2K2)
   05231 Choline metabolism in cancer
    113242822 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113242822 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113242822 (MAP2K2)
   05225 Hepatocellular carcinoma
    113242822 (MAP2K2)
   05226 Gastric cancer
    113242822 (MAP2K2)
   05214 Glioma
    113242822 (MAP2K2)
   05216 Thyroid cancer
    113242822 (MAP2K2)
   05221 Acute myeloid leukemia
    113242822 (MAP2K2)
   05220 Chronic myeloid leukemia
    113242822 (MAP2K2)
   05218 Melanoma
    113242822 (MAP2K2)
   05211 Renal cell carcinoma
    113242822 (MAP2K2)
   05219 Bladder cancer
    113242822 (MAP2K2)
   05215 Prostate cancer
    113242822 (MAP2K2)
   05213 Endometrial cancer
    113242822 (MAP2K2)
   05224 Breast cancer
    113242822 (MAP2K2)
   05223 Non-small cell lung cancer
    113242822 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113242822 (MAP2K2)
   05020 Prion diseases
    113242822 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113242822 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113242822 (MAP2K2)
   05135 Yersinia infection
    113242822 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113242822 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    113242822 (MAP2K2)
   05164 Influenza A
    113242822 (MAP2K2)
   05161 Hepatitis B
    113242822 (MAP2K2)
   05160 Hepatitis C
    113242822 (MAP2K2)
   05163 Human cytomegalovirus infection
    113242822 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113242822 (MAP2K2)
   05165 Human papillomavirus infection
    113242822 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113242822 (MAP2K2)
   01522 Endocrine resistance
    113242822 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113242822 (MAP2K2)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     113242822 (MAP2K2)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: STE group
  STE7 family
   113242822 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 113242822
NCBI-ProteinID: XP_026336867
UniProt: A0A3Q7VG39
LinkDB
Position
Unknown
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLAELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPVVDGVEGEPHSISPRPRP
PGRPISGHGTDSRPAMAIFELLDYIVNEPPPKLPSGVFTQDFQEFVNKCLIKNPAERADL
KMLMSHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRAAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcactatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctccaaaagaag
ctagcagagctagaactcgacgagcagcagaagaagcgactggaagccttcctcacccag
aaggccaaggttggggagctcaaggacgatgacttcgaacggatctcggagctgggagcc
gggaacggcggggtggtcaccaaggtccagcacagaccttccggcctcatcatggcgaga
aagctgatccacctggaaatcaagccggccatccggaaccagatcatccgcgagctgcag
gtgctgcacgagtgtaactcgccgtacatcgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggacggcggctctctggaccaggtgttgaaa
gaagccaagagaattcccgaggagatcctggggaaggtcagcattgcggttctccggggt
ttggcgtatctccgggaaaagcaccagatcatgcaccgagacgtgaaaccttccaacatc
ctcgtcaactcccgaggggagattaagctgtgcgattttggggtgagcggacagctcatt
gactccatggccaactccttcgtggggacccggtcctacatgtctccagagcggttgcag
ggcactcactactctgtgcagtcggacatctggagcatgggcctgtccctggtggagctg
tccatcggaaggtaccccatccccccgccggacgccaaggagctagaggccatatttggc
cggcccgtggtggacggggtagaaggagagcctcacagcatctcaccacggccgagaccc
cctggacgccccattagcggtcacgggacggacagccggccggccatggccatcttcgag
ctgctggactatatcgtgaacgagccacctcccaagctgcccagtggcgtcttcacccag
gacttccaggagtttgtaaataaatgcctaataaagaacccagcagagcgagcggatctg
aagatgctcatgagccacaccttcatcaagcggtccgaggtggaagaagtggattttgcc
ggctggttgtgtaaaacgctgcggctgaaccagcccagcacgcccacgcgcgccgccgtg
tga

DBGET integrated database retrieval system