KEGG   Ursus arctos horribilis: 113240901
Entry
113240901         CDS       T05909                                 

Gene name
PIAS1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
uah  Ursus arctos horribilis
Pathway
uah04120  Ubiquitin mediated proteolysis
uah04630  Jak-STAT signaling pathway
uah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    113240901 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113240901 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    113240901 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:uah04121]
    113240901 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113240901 (PIAS1)
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     113240901 (PIAS1)
Ubiquitin system [BR:uah04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   113240901 (PIAS1)
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    113240901 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 113240901
NCBI-ProteinID: XP_026334171
UniProt: A0A3Q7TEN6
LinkDB
Position
Unknown
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVTSHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYASSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHGHTVANRSGTDAASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgcagtcctgctgtacaaatgaaaattaaagaactc
tataggcggaggttcccccagaaaatcatgacgcccgcggacttgtccatccccaatgtc
cattcaagtcctatgccagcaactttgtctccatctaccattccacagctcacttatgat
ggtcaccctgcatcatcaccgttactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgcattgacaccacaacaagtgcagcaa
atcagtagttccatggatatttctgggaccaaatgtgacttcacagtgcaggtccagtta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccgggttatcttccacctacaaaaaatggt
gtggaaccaaagcgacccagccgaccaatcaatatcacctcacttgtccgattgtccaca
acagtaccaaacaccattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtgtatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaaattgactgcggatcca
gacagtgaaatagctacaaccagcctaagggtttctctactatgtccacttggtaaaatg
cggctgacgattccatgccgggccctgacatgctctcatctgcagtgttttgatgcaact
ctttatattcagatgaatgagaaaaaaccaacctgggtttgtcctgtctgtgataagaag
gctccgtatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gactgcgatgagatacagtttaaggaggatggctcttgggcacctatgagatcaaaaaag
gaagtacaagaagtctctgcctcttacaatggagttgatgggtgcttgagctccacattg
gagcatcaggtgacttctcaccaccagtcctcaaataaaaataagaaagtagaggtgatt
gacttaaccatagacagttcatctgatgaagaggaggaagagccgtctgccaagaggacc
tgtccttccctatctcccacatcaccactaaataataaaggcatattaagtcttccacat
caagcatctccagtgtcccgcaccccaagcctccctgctgtagacacaagctacattaat
acatccctcatccaagactacaggcatcctttccacatgacacccatgccttatgaccta
caaggattagatttctttcctttcttatcaggagacaatcagcattataacacctccctc
ctggccgccgctgccgccgcagtgtcagatgaccaggacctcttacactcgtctcggttt
ttcccgtacgcctcctcgcagatgtttctcgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggaagtagtagtggcagtaacagcagcctcgtgtcctccaacagc
ctgcgggagagccacggccacaccgtcgccaacaggagcggcacggacgcggcgtccatc
ttcggcatcataccagacattatttcgttggactga

KEGG   Ursus arctos horribilis: 113242820
Entry
113242820         CDS       T05909                                 

Gene name
PIAS4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
uah  Ursus arctos horribilis
Pathway
uah04064  NF-kappa B signaling pathway
uah04120  Ubiquitin mediated proteolysis
uah04630  Jak-STAT signaling pathway
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    113242820 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113242820 (PIAS4)
   04064 NF-kappa B signaling pathway
    113242820 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113242820 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:uah04121]
    113242820 (PIAS4)
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113242820 (PIAS4)
Ubiquitin system [BR:uah04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   113242820 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP CENP-B_dimeris Sporozoite_P67
Other DBs
NCBI-GeneID: 113242820
NCBI-ProteinID: XP_026336864
UniProt: A0A3Q7V1U1
LinkDB
Position
Unknown
AA seq 514 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKSSEPVPQAHRPLDPLTMHSTYDRAGTVPRTPLSGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGIKAVQVVLRICYSDTSGPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWLCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQCP
ILVLGPSDANGLLSTPNVNGGGGGGALGGAGGGGGAVGGVENGKPGADVVDLTLDSSSSS
EEEEEEEEDEEDEDEEGPRPKRRCPFQKGLVSAC
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagtttccgagtctccgatctt
cagatgcttctgggttttgttggccggagtaagagtggacttaagcacgaacttgtcacc
cgggccctccagctggtccagtttgactgtagccccgagctgttcaagaagatcaaggag
ctgtacgagacacgctacgccaagaagagctcagagcctgtcccccaggcccaccggccg
ctggaccccctgaccatgcactcaacctacgaccgggctggcacagtgcccaggactccc
ctctcgggccccaacattgactaccccgtgctctacgggaagtacttgaatggacttgga
cgcttgcccgccaagaccctcaagccagaagtgcgtctggtgaagctgcccttctttaac
atgctggacgagctgctgaagcccacagagctggttccacagaataatgagaagcttcaa
gagagtccgtgcatctttgcattgacaccaaggcaagtggagctgatccggaattccaga
gaactgcagcccgggatcaaggccgtgcaggtcgtcctcagaatctgctactcagacacc
agcggccctcaggaggaccagtacccgcccaacatcgccgtgaaggtcaaccacagctac
tgctcggtcccgggctactacccctccaacaagcccggagtggagcccaagaggccctgc
cgccccatcaacctcacccacctcatgtacctgtcctcggccaccaaccgcatcaccgtg
acctgggggaactacggcaagagttactccgtggccttgtacttggtgcggcagctgacc
tcttcggagctgctgcagagattgaaaaccatcggggtcaagcacccggagctgtgcaag
gcactggtcaaagagaagctgcgtctggaccctgacagcgagatcgccaccaccggcgtg
cgggtctccctcatctgcccactggtgaagatgcggctgtcggtgccctgccgggcggag
acctgcgcgcacctgcagtgcttcgacgccgtcttctacctccagatgaatgagaagaag
cccacctggctgtgccccgtgtgtgacaagccggccccctacgaccagctcatcatcgac
gggctcctctccaagatcctgagtgagtgcgaggatgccgacgagatcgagtacctggtg
gatggctcgtggtgcccgatccgcgccgagaaggagcgcagctgcagcccccagtgcccc
atcctcgtgctcggcccctcggacgccaatgggctcctttccacccccaacgtcaacggt
ggtggcggtggcggtgcgcttgggggcgccggtggcgggggcggcgcggtaggcggtgtt
gagaacgggaagccgggagccgacgtggtggacctcacgctggacagctcgtcatcctcg
gaggaggaggaggaggaggaagaggacgaggaggacgaggatgaggagggcccccggccc
aagcgacgctgtcccttccagaagggcctggtgtcggcctgctga

KEGG   Ursus arctos horribilis: 113247782
Entry
113247782         CDS       T05909                                 

Gene name
PIAS3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
uah  Ursus arctos horribilis
Pathway
uah04120  Ubiquitin mediated proteolysis
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    113247782 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113247782 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:uah04121]
    113247782 (PIAS3)
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     113247782 (PIAS3)
Ubiquitin system [BR:uah04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   113247782 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 113247782
NCBI-ProteinID: XP_026344884
UniProt: A0A3Q7VQ46
LinkDB
Position
Unknown
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALQLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTPPVGSPGPLAPIPPALLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSENKKKVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSTTPAPPPGRVSSIVAPG
GALREGPGGPLSSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagcttccgggtgtctgagcttcag
gtgctgctcggctttgctggccggaacaagagtggacggaagcacgagctcttggccaag
gccctgcagctcctcaaatccagctgtgcccccagtgtccagatgaagatcaaagagctt
taccgccgacgctttccccggaagaccctggggccctctgatctctccctgctctctctg
ccccctggcacccctcctgtcggctcccctggtcctctagctcccattccccccgccctc
ttggcccctggcactctgctgggccccaagcgtgaagtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaagtctacggggag
ctcatccggcccaccaccctcgcgtccacttctagccagaggtttgaagaggcgcacttt
acctttgccctcacaccccagcaagtgcagcagattctcacgtccagagaggttctacca
ggagcgaaatgtgactatactatacaagtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaggattattttccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttccccctaccaagaatggggctgagcccaagaggcctagccgc
cccatcaacatcacacctctggctcgtctctcggccactgttcccaacaccatcgtggtc
aactggtcatctgagtttggacggaactactccttgtctgtgtacctggtgaggcagttg
actgcagggacccttctacaaaaactgagagcaaagggtatccggaacccagaccactct
cgggcactgatcaaggagaaattgaccgctgacccggacagtgaggtggccactacaagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgccttacggtcccttgtcgtgcc
ctcacctgcgcccacctgcagagcttcgatgctgccctttacctacagatgaatgagaag
aagccaacatggacatgtcctgtgtgtgacaagaaggctccttacgaatctcttatcatt
gatggcttattcatggagatacttaattcctgttcggattgtgatgagatccagttcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtacagcccagtccaagagggcaatccatcagag
aataagaagaaggttgaagttattgacttgacaatagagagttcatcagatgaggaggac
ctgcccccgaccaaaaagcactgtcctgtcacctcagctgccatcccggctctacctgga
agcaaaggagtcctgacatctggtcaccagccgtcctcggtgctacggagccctgctatg
ggcacgctgggcggggatttcctgtccagtctcccactacacgagtacccacctgctttc
ccactgggggccgatatccaaggtttagatttattttctttcctccagactgagagtcag
cactatggtccctccgtcatcacctcgctagatgaacaggatacccttggccacttcttc
cagtaccgagggaccccttcccacttcctgggcccactggcccccacgttggggagctct
caccgcagcaccactccagcaccccctcctggccgggtcagtagcattgtggcccctggg
ggggccttgagggaggggcctggaggacccctgtcctcaggtccctctttgactggctgc
cggtcagacatcatttccctggactga

KEGG   Ursus arctos horribilis: 113253381
Entry
113253381         CDS       T05909                                 

Gene name
PIAS2
Definition
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X1
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
uah  Ursus arctos horribilis
Pathway
uah04120  Ubiquitin mediated proteolysis
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    113253381 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113253381 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:uah04121]
    113253381 (PIAS2)
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     113253381 (PIAS2)
Ubiquitin system [BR:uah04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   113253381 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 113253381
NCBI-ProteinID: XP_026352038
UniProt: A0A3Q7VSS1
LinkDB
Position
Unknown
AA seq 622 aa
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFNLDGSSSPVEPDLAVAGIHALPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGTWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVANETSKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSS
SRSETGVITSSGSNIPDIISLD
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcggatttcgaggagttgaggaatatggtttctagctttagggtttctgaactacaa
gtgttactaggctttgctggacggaataaaagtggacgcaagcatgacctcctgatgagg
gcgttgcatttattgaagagcggctgcagccctgcggttcagattaaaatccgagaattg
tacagacgtcgatacccacggactcttgaaggactttctgatttatccacaatcaaatct
tcagttttcaatttggatggtagctcatcacctgtagagcctgacttggccgtggctgga
atccacgcgctgccttccacctcagttacaccgcactcaccgtcctctcctgttggttct
gtgctgcttcaggatactaagcccacgtttgagatgcagcagccatctcccccaattcct
cctgtccatcctgatgtgcagttaaaaaacttgccgttttatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcaacgatttcaagagaagttttttatt
tttgctctgacacctcagcaagttagagagatatgcatatccagggattttttgccaggt
ggtaggagagattatacagtccaggttcagctgagactttgcctggcagagacaagttgc
cctcaagaagacaactatcccaatagtctatgtataaaagtaaatgggaagctgtttcct
ttgcctggctatgcaccaccacctaaaaatgggattgaacagaaacgccctggacgccct
ttgaatattacatctttagttaggttatcttcagctgtgccaaaccagatttccatttct
tgggcatcagaaatcggaaagaattactccatgtctgtatatcttgtacgacagctcaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccaga
gcactaattaaagaaaaacttactgcagatcctgatagtgaaattgctacaactagcctt
cgggtatccttgatgtgccctttagggaaaatgaggttgacaatcccatgccgtgcagtg
acttgtacacatctacagtgttttgacgctgcgctttatctgcaaatgaatgagaagaag
cccacctggatctgtcctgtgtgtgacaaaaaagctgcctatgaaagtctaattttagat
gggctttttatggaaattctcaatgactgttctgatgtggatgagatcaaattccaagag
gatggcacttggtgtccaatgagaccgaagaaagaagctatgaaagtgtccagccagccg
tgtacaaaaatagaaagttcaagtgtcctcagtaagccttgttcagtgactgtagccaat
gagacaagcaagaagaaagtggatgttattgacctaacaatagaaagctcttctgatgaa
gaggaagaccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggtt
gatcctgctgctattccgccttcattaacagactactcagtaccattccaccacacgcca
atatcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagcagtactgtcctcctatgtttttggatagtctcacctcacccctaacagcaagc
agtacgtctgtcaccaccaccagcccccatgaaagcagtactcatgttagttcatccagc
agcaggagtgagacaggggtcataaccagcagtggaagtaacattcctgacatcatctca
ttggactaa

DBGET integrated database retrieval system