KEGG   Ursus arctos horribilis: 113241140
Entry
113241140         CDS       T05909                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha isoform X1
  KO
K05068  interleukin 2 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113241140 (IL2RA)
   04151 PI3K-Akt signaling pathway
    113241140 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113241140 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113241140 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113241140 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113241140 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    113241140 (IL2RA)
   04659 Th17 cell differentiation
    113241140 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113241140 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113241140 (IL2RA)
   05162 Measles
    113241140 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113241140 (IL2RA)
   04090 CD molecules [BR:uah04090]
    113241140 (IL2RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113241140 (IL2RA)
CD molecules [BR:uah04090]
 Proteins
  113241140 (IL2RA)
SSDB
Motif
Pfam: Sushi Ntox37
Other DBs
NCBI-GeneID: 113241140
NCBI-ProteinID: XP_026334496
UniProt: A0A3Q7TF97
LinkDB
Position
Unknown
AA seq 267 aa
MEPSLLMWGISTFVTVSAYVTDLCDGYPPDLKHATYRALEYKTGTVLNCGCERGYRRLSN
FMHCAGNASHASWENRCQCRSTSSKSTERQITPRPKEQKEMQSPTPPGDQGNLLGHCREP
PSWEHEDPKRIYHFAVGQTVHYQCAQGFRALHRGSAQSVCKRISGKTQWSQPQLKCISER
TDSPFPDDEEEPQASTRAPGRDTSSPLQMTSTTDFHKHTEVATSAESFIFTTEYQIAVAG
CVLLLISVLLLSGLTWQRRWRKSRRTI
NT seq 804 nt   +upstreamnt  +downstreamnt
atggagccaagcttgctgatgtggggaatctctacattcgtcacagtgtctgcctacgtg
acagacctgtgtgacggttacccgccagacctcaagcacgccacatacagagctctcgag
tacaagacgggcacggtgttaaattgtgggtgtgagagaggctaccgcagactaagcaac
ttcatgcattgtgcgggaaacgccagccacgcttcctgggaaaacagatgccagtgcaga
agtacatcctccaagagcacagaaagacaaattactcctagacccaaagaacagaaggaa
atgcagagcccaacgccgcccggggaccaagggaaccttctaggtcactgcagggagcct
ccttcctgggaacatgaagatccaaagagaatctaccacttcgcggtggggcagacggtt
cactaccagtgcgcgcagggattcagggccctacacagaggttctgcccagagcgtctgc
aaaaggatctcagggaagacccagtggtcacagccccagctcaagtgcataagtgagagg
acggacagtccgtttccagatgacgaagaagagcctcaagcaagcacccgtgctcctggg
agagacacttcctcccccttgcaaatgacaagtactaccgatttccacaaacacacggaa
gtggctacctccgcagagtcgttcatattcacaaccgagtatcagatagcagtggccggc
tgcgttctcctgctgatcagcgtcctccttctgagcgggctcacctggcagcggagatgg
aggaagagtagaagaaccatctag

DBGET integrated database retrieval system