KEGG   Ursus arctos horribilis: 113241140
Entry
113241140         CDS       T05909                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha isoform X1
  KO
K05068  interleukin 2 receptor alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113241140 (IL2RA)
   04151 PI3K-Akt signaling pathway
    113241140 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113241140 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113241140 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113241140 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113241140 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    113241140 (IL2RA)
   04659 Th17 cell differentiation
    113241140 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113241140 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113241140 (IL2RA)
   05162 Measles
    113241140 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113241140 (IL2RA)
   04090 CD molecules [BR:uah04090]
    113241140 (IL2RA)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113241140 (IL2RA)
CD molecules [BR:uah04090]
 Proteins
  113241140 (IL2RA)
SSDB
Motif
Pfam: Sushi Ntox37
Other DBs
NCBI-GeneID: 113241140
NCBI-ProteinID: XP_026334496
UniProt: A0A3Q7TF97
LinkDB
Position
Unknown
AA seq 267 aa
MEPSLLMWGISTFVTVSAYVTDLCDGYPPDLKHATYRALEYKTGTVLNCGCERGYRRLSN
FMHCAGNASHASWENRCQCRSTSSKSTERQITPRPKEQKEMQSPTPPGDQGNLLGHCREP
PSWEHEDPKRIYHFAVGQTVHYQCAQGFRALHRGSAQSVCKRISGKTQWSQPQLKCISER
TDSPFPDDEEEPQASTRAPGRDTSSPLQMTSTTDFHKHTEVATSAESFIFTTEYQIAVAG
CVLLLISVLLLSGLTWQRRWRKSRRTI
NT seq 804 nt   +upstreamnt  +downstreamnt
atggagccaagcttgctgatgtggggaatctctacattcgtcacagtgtctgcctacgtg
acagacctgtgtgacggttacccgccagacctcaagcacgccacatacagagctctcgag
tacaagacgggcacggtgttaaattgtgggtgtgagagaggctaccgcagactaagcaac
ttcatgcattgtgcgggaaacgccagccacgcttcctgggaaaacagatgccagtgcaga
agtacatcctccaagagcacagaaagacaaattactcctagacccaaagaacagaaggaa
atgcagagcccaacgccgcccggggaccaagggaaccttctaggtcactgcagggagcct
ccttcctgggaacatgaagatccaaagagaatctaccacttcgcggtggggcagacggtt
cactaccagtgcgcgcagggattcagggccctacacagaggttctgcccagagcgtctgc
aaaaggatctcagggaagacccagtggtcacagccccagctcaagtgcataagtgagagg
acggacagtccgtttccagatgacgaagaagagcctcaagcaagcacccgtgctcctggg
agagacacttcctcccccttgcaaatgacaagtactaccgatttccacaaacacacggaa
gtggctacctccgcagagtcgttcatattcacaaccgagtatcagatagcagtggccggc
tgcgttctcctgctgatcagcgtcctccttctgagcgggctcacctggcagcggagatgg
aggaagagtagaagaaccatctag

KEGG   Ursus arctos horribilis: 113245610
Entry
113245610         CDS       T05909                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma isoform X1
  KO
K05070  interleukin 2 receptor gamma
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113245610 (IL2RG)
   04151 PI3K-Akt signaling pathway
    113245610 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113245610 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113245610 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113245610 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113245610 (IL2RG)
   04659 Th17 cell differentiation
    113245610 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113245610 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113245610 (IL2RG)
   05340 Primary immunodeficiency
    113245610 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113245610 (IL2RG)
   05162 Measles
    113245610 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113245610 (IL2RG)
   04090 CD molecules [BR:uah04090]
    113245610 (IL2RG)
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113245610 (IL2RG)
CD molecules [BR:uah04090]
 Proteins
  113245610 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 113245610
NCBI-ProteinID: XP_026341554
UniProt: A0A3Q7VF95
LinkDB
Position
Unknown
AA seq 383 aa
MLKPPLPLRSLLFLQLPLLGVGLNSTVPMPNGNEDVTAGGKRGTEGVDFFLTATPPGTLS
VSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPINLTLNYWYKNSKDDKVQECGHYLFSGET
TAGCWLQKEEIHLYETFVVQLQDPQEPRRQSIQMLKLQNLVIPWAPENLTLRNLSESQLE
LSWSNRHLDHCLEHLVQYRSDWDRSWTEQSVDHRNSFSLPSVDGQKFYTFRVRSRYNPLC
GSAQRWSEWSHPIHWGSNTSKENPLLFASEAVLIPLGSMGLIICLICVYYWLERVMPRIP
TLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPC
SQHSPYWAPPCYTLKPETGALIP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgttgaagccaccattgccactcagatccctcttattcctgcagctgcctctgctgggg
gtggggctgaactcgacggtccccatgcccaatgggaatgaagacgtcacagctggtggg
aaacgtgggactgaaggggttgatttcttcctgaccgctacaccccctgggaccctcagc
gtttctaccctgcccctcccagaggtccagtgttttgtgttcaatgttgagtacatgaat
tgcacttggaacagcagctctgagccccagcccatcaacctgactctgaactactggtac
aagaactccaaggatgataaagtccaggagtgtggccactatctattttctggagagacc
actgctggctgttggctgcaaaaggaggagatccatctctacgaaacatttgttgtccag
ctccaggacccacaggaacccaggaggcagtccatacagatgctaaaactgcagaatctg
gtgatcccctgggctccggagaacctaacccttcgcaacctgagcgaatcccagctagaa
ctgagctggagcaacagacacttggaccactgtttggagcacctcgtgcagtaccggagt
gactgggaccgcagctggactgaacaatccgtggaccaccgaaatagcttttctctgcct
agcgtggatgggcagaaattctacacgttccgtgtccggagccgctataacccactctgt
ggaagcgctcagcgttggagtgaatggagccaccccatccactggggcagcaatacttcc
aaggagaatcctttgttgtttgcatcggaagctgtgcttatcccccttggctccatggga
ttgattatttgccttatctgtgtgtactactggctggaacgggtgatgccccgaattcct
accctcaagaacctagaggatctggttactgaataccacgggaacttttcggcctggagt
ggagtgtctaagggactggcggagagtctgcagccagactacagtgaatggctctgccac
gtcagtgagattcccccaaaaggaggggctccaggggaggggcctgggggctccccctgc
agccagcatagcccctactgggctcccccatgttacaccctgaaacctgaaactggagcc
ctgataccctga

KEGG   Ursus arctos horribilis: 113249383
Entry
113249383         CDS       T05909                                 

Definition
(RefSeq) interleukin-2 receptor subunit beta-like isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113249383
   04151 PI3K-Akt signaling pathway
    113249383
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113249383
   04061 Viral protein interaction with cytokine and cytokine receptor
    113249383
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113249383
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113249383
   04659 Th17 cell differentiation
    113249383
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113249383
   05202 Transcriptional misregulation in cancer
    113249383
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113249383
   05162 Measles
    113249383
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113249383
   04090 CD molecules [BR:uah04090]
    113249383
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113249383
CD molecules [BR:uah04090]
 Proteins
  113249383
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 113249383
NCBI-ProteinID: XP_026346683
UniProt: A0A3Q7W8J1
LinkDB
Position
Unknown
AA seq 555 aa
MDVMAAPALSCSLSLLVLLLALAIPRGSTVANDSSKLTCFYNSKANISCVWSWDGDPQVT
SCKIHAQPERRPWNRSCDLLLMSPAFWACHLILGSPDAQSLTAADIVNMSVMCREGDRWR
TLMTQDFKPFENLRLMAPDLLQVTHVGTHKCNITWKVPQSSHYIESYLEFEARRRSPGHS
WEEASLLVLRQNQQWICLDTLTPGTLYEFQVRVRAYLGSHKAWSPWSQPLAFRTKPAEKQ
TPLFPWFGHVIMGVSSALGFIILVYLLANCQYSGPRLKKVLKCHIPDPSEFFSQLKSEHG
GDFQKWLSSPFPSSSFSPNTQAPEISPLEVLDRDAKATQLLLLQQEKGPSPSTETSGHSL
TSCFTNQGYFFFHLPDALEIEACQVYFTYDPCTEEPEEGGPGAPEGSLLPPLRPLPAEDD
AYCTFPPGDDLLLFSPGLLGGPGPPNTALGGAGAGGEKLPPSLQEGAPRAWAPQPLEPPT
PGAPDPGDSQPPLELALREAREEVPAPGPGEGVGFPWASPSGRGQVRALTSCLTLNTDAY
LSLQELQDQDPAHSV
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggatgtgatggcagctcctgctctgtcctgctctctgtccctccttgtcctcctcctg
gccctggccatccctcggggatccacagtggcaaatgactcttccaagctcacatgcttc
tacaactcaaaagccaacatctcctgtgtctggagctgggatggggacccgcaggtcaca
tcctgcaagatccatgctcagccggagagacggccttggaacagatcctgtgacctgctc
ctgatgagcccggcattctgggcctgtcacctgatccttgggtccccagatgctcagagt
ctgacagcagctgacatcgtcaacatgagtgtaatgtgccgtgaaggcgacaggtggagg
acactgatgacccaggacttcaagccctttgagaaccttcgcctgatggcccccgacttg
ctccaagtcacccacgtcgggacccacaaatgcaacataacctggaaagtccctcagtcc
tcccactacattgaaagttacctggagtttgaggctcggagaaggtccccaggccacagc
tgggaggaggcctccctgcttgtcctcaggcagaaccagcaatggatttgcctagacaca
ctcactccaggcaccctgtacgaatttcaagtgagggtaagggcctacctaggcagccac
aaggcttggagtccctggagtcagcccctggccttcaggacgaagcctgcagagaagcag
accccgctcttcccttggtttggccacgtcatcatgggtgtcagcagcgccttgggcttt
atcatcttggtctacttgttggccaactgtcagtacagcggaccacggctgaagaaggtt
ctgaagtgccatatcccagacccctccgagttcttttcccagctgaagtcagagcatggg
ggagatttccagaagtggctgtcctcgcccttcccctcgtcatctttcagccccaacacc
caggcacccgagatctccccgctggaggtgctggacagggacgccaaggccacacagctg
ctcctgctgcagcaggagaaggggccctctccctccaccgagacgagcggccactcgctg
accagctgcttcaccaaccagggttacttcttcttccacctccccgacgccctggagatc
gaggcctgccaggtgtacttcacctatgatccctgcacagaagagcccgaggagggcggg
cctggggcgcccgaggggtctctcctcccgcccctgcgacccctgccagccgaggatgat
gcctactgcaccttcccccctggggatgacctgctgctcttctctcctggtctccttggc
ggccccggcccccccaacacggccctgggcggcgctggagctggtggagagaagctgccc
ccctcattgcaggaaggagctcccagagcctgggccccccagcccctggagcctcccacc
ccaggagctcctgacccgggggatagccagccgcccctggagcttgccctgagagaagca
agagaggaggtcccagccccaggccccggggagggagtcggcttcccctgggctagcccc
tctggacgaggccaggtcagggcccttacctcctgcctgaccctgaacaccgatgcttac
ctgtccctccaagagctgcaggatcaggacccggctcattcggtgtag

KEGG   Ursus arctos horribilis: 113249385
Entry
113249385         CDS       T05909                                 

Definition
(RefSeq) interleukin-2 receptor subunit beta-like isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04144  Endocytosis
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113249385
   04151 PI3K-Akt signaling pathway
    113249385
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113249385
   04061 Viral protein interaction with cytokine and cytokine receptor
    113249385
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113249385
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113249385
   04659 Th17 cell differentiation
    113249385
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113249385
   05202 Transcriptional misregulation in cancer
    113249385
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113249385
   05162 Measles
    113249385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:uah04050]
    113249385
   04090 CD molecules [BR:uah04090]
    113249385
Cytokine receptors [BR:uah04050]
 Interleukin receptor families
  IL2 receptor family
   113249385
CD molecules [BR:uah04090]
 Proteins
  113249385
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 113249385
NCBI-ProteinID: XP_026346687
UniProt: A0A3Q7W8J1
LinkDB
Position
Unknown
AA seq 555 aa
MDVMAAPALSCSLSLLVLLLALAIPRGSTVANDSSKLTCFYNSKANISCVWSWDGDPQVT
SCKIHAQPERRPWNRSCDLLLMSPAFWACHLILGSPDAQSLTAADIVNMSVMCREGDRWR
TLMTQDFKPFENLRLMAPDLLQVTHVGTHKCNITWKVPQSSHYIESYLEFEARRRSPGHS
WEEASLLVLRQNQQWICLDTLTPGTLYEFQVRVRAYLGSHKAWSPWSQPLAFRTKPAEKQ
TPLFPWFGHVIMGVSSALGFIILVYLLANCQYSGPRLKKVLKCHIPDPSEFFSQLKSEHG
GDFQKWLSSPFPSSSFSPNTQAPEISPLEVLDRDAKATQLLLLQQEKGPSPSTETSGHSL
TSCFTNQGYFFFHLPDALEIEACQVYFTYDPCTEEPEEGGPGAPEGSLLPPLRPLPAEDD
AYCTFPPGDDLLLFSPGLLGGPGPPNTALGGAGAGGEKLPPSLQEGAPRAWAPQPLEPPT
PGAPDPGDSQPPLELALREAREEVPAPGPGEGVGFPWASPSGRGQVRALTSCLTLNTDAY
LSLQELQDQDPAHSV
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggatgtgatggcagctcctgctctgtcctgctctctgtccctccttgtcctcctcctg
gccctggccatccctcggggatccacagtggcaaatgactcttccaagctcacatgcttc
tacaactcaaaagccaacatctcctgtgtctggagctgggatggggacccgcaggtcaca
tcctgcaagatccatgctcagccggagagacggccttggaacagatcctgtgacctgctc
ctgatgagcccggcattctgggcctgtcacctgatccttgggtccccagatgctcagagt
ctgacagcagctgacatcgtcaacatgagtgtaatgtgccgtgaaggcgacaggtggagg
acactgatgacccaggacttcaagccctttgagaaccttcgcctgatggcccccgacttg
ctccaagtcacccacgtcgggacccacaaatgcaacataacctggaaagtccctcagtcc
tcccactacattgaaagttacctggagtttgaggctcggagaaggtccccaggccacagc
tgggaggaggcctccctgcttgtcctcaggcagaaccagcaatggatttgcctagacaca
ctcactccaggcaccctgtacgaatttcaagtgagggtaagggcctacctaggcagccac
aaggcttggagtccctggagtcagcccctggccttcaggacgaagcctgcagagaagcag
accccgctcttcccttggtttggccacgtcatcatgggtgtcagcagcgccttgggcttt
atcatcttggtctacttgttggccaactgtcagtacagcggaccacggctgaagaaggtt
ctgaagtgccatatcccagacccctccgagttcttttcccagctgaagtcagagcatggg
ggagatttccagaagtggctgtcctcgcccttcccctcgtcatctttcagccccaacacc
caggcacccgagatctccccgctggaggtgctggacagggacgccaaggccacacagctg
ctcctgctgcagcaggagaaggggccctctccctccaccgagacgagcggccactcgctg
accagctgcttcaccaaccagggttacttcttcttccacctccccgacgccctggagatc
gaggcctgccaggtgtacttcacctatgatccctgcacagaagagcccgaggagggcggg
cctggggcgcccgaggggtctctcctcccgcccctgcgacccctgccagccgaggatgat
gcctactgcaccttcccccctggggatgacctgctgctcttctctcctggtctccttggc
ggccccggcccccccaacacggccctgggcggcgctggagctggtggagagaagctgccc
ccctcattgcaggaaggagctcccagagcctgggccccccagcccctggagcctcccacc
ccaggagctcctgacccgggggatagccagccgcccctggagcttgccctgagagaagca
agagaggaggtcccagccccaggccccggggagggagtcggcttcccctgggctagcccc
tctggacgaggccaggtcagggcccttacctcctgcctgaccctgaacaccgatgcttac
ctgtccctccaagagctgcaggatcaggacccggctcattcggtgtag

DBGET integrated database retrieval system