KEGG   Ursus arctos horribilis: 113241157
Entry
113241157         CDS       T05909                                 

Gene name
GATA3
Definition
(RefSeq) trans-acting T-cell-specific transcription factor GATA-3 isoform X1
  KO
K17895  GATA-binding protein 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04928  Parathyroid hormone synthesis, secretion and action
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113241157 (GATA3)
   04659 Th17 cell differentiation
    113241157 (GATA3)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    113241157 (GATA3)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113241157 (GATA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:uah03000]
    113241157 (GATA3)
Transcription factors [BR:uah03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    113241157 (GATA3)
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon ArfGap DZR_2 Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 113241157
NCBI-ProteinID: XP_026334526
UniProt: A0A3Q7V9K8
LinkDB
Position
Unknown
AA seq 444 aa
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMDPAQYPLPEEVDVLFNIDGQGNHV
PSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSGRQDE
KECIKYQVPLPDSMKLESTHSRGSMTTLGGAASSAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDTLEDFPKSSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggaggtgacggcggaccagccgcgctgggtgagccaccaccaccccgcggtcctcaac
gggcagcacccggacacgcaccacccgggcctcggccactcctacatggacccggcgcag
taccccctgcccgaggaggtggatgtactttttaacatcgacggtcaaggcaaccacgtc
ccttcctactacggaaactccgtgagggccacggtgcagaggtatcctccgacccaccac
ggaagtcaggtgtgccgcccacctctgctccacggatccctgccctggctggacggcggc
aaagcgctgggcagccaccacaccgcttcgccctggaacctcagccccttctccaagacg
tccatccaccacggctccccggggccgctctccgtctaccccccggcctcttcctcctcg
ctgtcggccggccactccagcccgcacctcttcaccttcccgcccaccccgccgaaggac
gtctccccggacccgtcgctgtccaccccgggctcggccggctcgggccggcaggacgag
aaggagtgcatcaaataccaggtgccgctgcccgacagcatgaagctcgagtccacgcac
tcgcggggcagcatgaccaccctgggaggggccgcctcgtcggcacaccaccccatcacc
acgtacccgccctacgtccccgaatacagctccggactcttcccgcccagcagcctgctg
gggggctcccccaccggcttcggatgtaagtcgaggcccaaggcgagatccagcacagaa
ggcagggagtgtgtgaactgcggggccacctcaaccccgctgtggcggcgggatggcact
gggcattacctctgcaacgcctgcgggctctaccacaaaatgaacggacagaaccgaccg
ctcatcaagcccaagcgaaggctgtcggcagcaagaagggctggtacgtcctgtgcgaac
tgtcaaaccaccaccacgacgctctggagaagaaatgccaacggagaccccgtctgtaac
gcctgtgggctgtactacaagcttcacaatattaacagacccctgaccatgaagaaggaa
ggcatccagaccagaaaccgaaaaatgtctagcaagtccaaaaagtgcaaaaaggtgcac
gacacgctggaggacttccccaagagcagctcgttcaacccggccgccctgtccagacac
atgtcctctctcagccacatctcccctttcagccactccagccacatgctgaccacgccg
acgccgatgcaccccccgtccagcctctccttcggacctcaccacccttccagtatggtc
accgccatgggttag

DBGET integrated database retrieval system