KEGG   Ursus arctos horribilis: 113241322Help
Entry
113241322         CDS       T05909                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
uah  Ursus arctos horribilis
Pathway
uah00250  Alanine, aspartate and glutamate metabolism
uah00410  beta-Alanine metabolism
uah00430  Taurine and hypotaurine metabolism
uah00650  Butanoate metabolism
uah01100  Metabolic pathways
uah04727  GABAergic synapse
uah04940  Type I diabetes mellitus
Module
uah_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    113241322 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    113241322 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113241322 (GAD2)
   00430 Taurine and hypotaurine metabolism
    113241322 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    113241322 (GAD2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113241322 (GAD2)
Enzymes [BR:uah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     113241322 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 113241322
NCBI-ProteinID: XP_026334704
UniProt: A0A3Q7UTI0
LinkDB All DBs
Position
Unknown
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SEPSRATSRKGACACNQKPCSCPKADVNYAFLHATDLLPACDGERPTLAFLQDVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRVLEDNEERMSRLSKVAPVIKARMMEH
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccaggctccggcttttggtccttcgggtctgaagatggctccggggatccc
gagaaccccggcacagcgagagcctggtgtcaggtggcccagaagttcacgggcggcatc
ggaaacaagctgtgcgccctgctctacggcgatgccgagaagccggcggagagtggcggg
agcgagccttcgcgggccacctcccggaagggcgcctgcgcctgtaatcagaagccttgc
agctgccccaaagcggatgtcaactatgcgtttctacatgcaacagacttgctgccagcg
tgtgacggagaaaggcccactttggcatttctgcaagatgttatggacattttgcttcaa
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
ctccttcaagagtataactgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacgactctaaaatatgcaattaaaacagggcatcccagatatttcaat
caactttccactggactggatatggttggattagcagcggactggctgacctcaacagca
aacacaaacatgttcacgtatgaaattgctccagtatttgtgctcttggaatatgtcaca
ctaaagaaaatgagagaaatcattggctggccagggggctctggcgatgggatattttct
cctggtggcgctatatctaacatgtatgccatgctgatcgcacgctttaagatgttccca
gaagtcaaggagaaaggaatggctgctgttcccaggctcattgccttcacatcggagcat
agtcatttttctctcaagaaaggagctgcagctttgggcatcggaacagacagcgtgatt
ctgattaaatgcgatgagagggggaaaatgatcccatctgaccttgaaagaaggatcctt
gaagccaaacaaaaaggatttgttcctttccttgtgagtgccacagctgggaccaccgtg
tatggagcctttgaccctctcttggcggttgctgacatttgcaaaaagtacaagatctgg
atgcatgtggatgcagcttggggtggaggactactgatgtcccggaagcacaaatggaaa
ctgagcggcgtggagagggccaattctgtgacatggaacccacacaagatgatgggcgtc
cctttgcagtgctccgcgctcctggttagagaagaggggttgatgcagagttgcaaccag
atgcatgcctcctacctcttccagcaagataagcactatgacctgtcctacgacactggg
gacaaggccttacagtgcggacgccacgtcgatgttttcaaattatggctaatgtggagg
gcgaagggcactactgggtttgaagcacatattgataagtgcttggagctggcagagtat
ttatacaatatcataaaaaacagagaaggatacgaaatggtgtttgatggaaagcctcag
cacacaaatgtctgcttctggtatgtgcctccaagtttgcgtgtcctggaagacaatgaa
gagagaatgagccgcctctcgaaggtggccccagtgattaaagctagaatgatggagcac
gggaccacaatggtcagctaccagcccttgggagacaaggtcaatttcttccgcatggtc
atctcaaatcccgcagcaactcaccaagacattgacttcctgatcgaagaaatagaacgc
cttggacaagatttataa

KEGG   Ursus arctos horribilis: 113250787Help
Entry
113250787         CDS       T05909                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
uah  Ursus arctos horribilis
Pathway
uah00250  Alanine, aspartate and glutamate metabolism
uah00410  beta-Alanine metabolism
uah00430  Taurine and hypotaurine metabolism
uah00650  Butanoate metabolism
uah01100  Metabolic pathways
uah04727  GABAergic synapse
uah04940  Type I diabetes mellitus
Module
uah_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    113250787 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    113250787 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113250787 (GAD1)
   00430 Taurine and hypotaurine metabolism
    113250787 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    113250787 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113250787 (GAD1)
Enzymes [BR:uah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     113250787 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase OKR_DC_1 SepSecS DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 113250787
NCBI-ProteinID: XP_026348367
UniProt: A0A3Q7WDG8
LinkDB All DBs
Position
Unknown
AA seq 594 aa AA seqDB search
MASSTPSSSATASNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGSA
LGFGTDNVILIKCNERGKIIPADLEAKILDAKQKGFVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRYKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttctaccccttcttcgtccgcaaccgcttcgaatgcgggagcggaccccaat
actaccaacctgcgccccacaacgtacgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatatgcggcttcttgcaaaggaccaacagcctggaagagaag
agccggcttgtgagcgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagtgacagggatggccgtttccggcgcacggagaccgacttctccaatctgtttgct
cgagatctgcttccggctaagaatggtgaggagcagaccgtgcagttcctactggaagtg
gtagacatactcctcaactatgtccgcaagacctttgatcgctccaccaaggtgctggac
ttccatcacccgcaccagctgctggaaggcatggagggcttcaacttggagctgtcggac
caccccgagtccctggagcagatcttggttgactgcagagacaccctgaagtacggcgtc
cgtacaggtcatcctcgatttttcaaccagctctccactggattggatatcattggttta
gctggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaatcgcacca
gtatttgtcctcatggagcaaataacacttaagaagatgagagagatagttggatggtca
agtaaagacggtgatgggatattttctcctgggggagccatctccaacatgtacagcatc
atggccgctcgatacaagttcttccccgaagttaagacaaagggcatggcggctgttccc
aaactggtcctcttcacctcagaacacagtcactattccataaagaaggctggatctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagaggcaaaaattcttgatgccaagcaaaagggattcgttcccctctat
gtcaatgcaactgcgggcacgacggtgtatggagcttttgatccaatccaggagattgca
gatatatgtgagaaatataacctatggcttcatgtcgacgctgcctggggcggcgggctg
ctcatgtccaggaagcaccgctacaaactcagtggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggtgtgctgttgcagtgctctgccattctcgtcaaggaa
aagggtatactccagggatgcaaccagatgtgtgccgggtaccttttccagccagacaag
cagtatgatgtctcctatgacactggggacaaggcaatccagtgtggccgccacgtggac
attttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaatcagatc
aacaaatgcttggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggtttttgatggtgagcctgaacatacaaacgtttgtttctggtatattccacaa
agcctcaggggcattccggatagccctgaacgacgggaaaaactacacagggtggccccc
aaaatcaaagcgctgatgatggagtctggcacgaccatggttggctaccagcctcagggg
gacaaggccaactttttccggatggtcatctcgaacccagccgctacgcagtctgatatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

KEGG   Ursus arctos horribilis: 113253470Help
Entry
113253470         CDS       T05909                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
uah  Ursus arctos horribilis
Pathway
uah00250  Alanine, aspartate and glutamate metabolism
uah00410  beta-Alanine metabolism
uah00430  Taurine and hypotaurine metabolism
uah00650  Butanoate metabolism
uah01100  Metabolic pathways
uah04727  GABAergic synapse
uah04940  Type I diabetes mellitus
Module
uah_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    113253470
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    113253470
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113253470
   00430 Taurine and hypotaurine metabolism
    113253470
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    113253470
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113253470
Enzymes [BR:uah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     113253470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DUF35_N DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 113253470
NCBI-ProteinID: XP_026352196
UniProt: A0A3Q7UUC7
LinkDB All DBs
Position
Unknown
AA seq 528 aa AA seqDB search
MRKSSGHTFQSTEKNVIKGAQTETVTTNLSNAYASDLLPSKDSKDLTKCFLLQVVNILLN
YIKKTFDVKSKILDFHHPHQLLEGLDGLDLELSDHPESLEQLLVDCTDTLKYGVKTGHPR
FFNQLSSGLDVVGLAGEWLTATANTNMFTYEIAPVFTVMETILLKKMYEIIGWRETEADG
IFAPGGSISNLYGILVARYKQYPEIKRQGMTALPCIVLFVSEQGHYSVKKAAAILGIGTD
NVIEVKCDERGKMIPAELEKNILQAKTKGQTPFCVTATAGTTVFGAFDPLHAIADICETH
RLWMHVDAAWGGGLLLSRNHAHKLSGIERANSVTWNPHKLMGVPLQCSAILIREKGLLEA
CNQMRAGYLFQPDKPYNVDFDTGDKTIQCGRHVDIFKLWLMWKAKGTRGFEAQINRYMEL
ATYFYKILKKKDNFKLVFDAEPEFTNVCFWYFPPRLKRIPKCFERDQELQKIAPKIKAQM
VEEGTAMISFQPCGDKVNFFRMVFSNPATRQADVDYLIDEIERLGKDL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaagttctggtcatacttttcagtcaactgagaaaaatgtgataaaaggtgct
cagactgagactgtaacgactaatttatcaaacgcttatgcttcagatttgttgccatcc
aaggatagtaaagatttaacaaaatgttttttgctacaagtggtaaatattcttctgaat
tacatcaaaaaaacttttgatgttaagagtaaaatactggactttcatcatcctcatcaa
cttcttgaaggtttggatgggttagacttagaactgtctgaccaccctgaatctttggag
caattacttgttgactgcacagataccttaaaatatggtgttaaaacaggacaccctcgc
ttttttaaccagctctccagtggcctagatgtcgtcggacttgccggggaatggttgacc
gccactgccaataccaacatgtttacctatgaaatagctccagtatttactgtcatggaa
acaattcttcttaagaaaatgtatgaaattattggctggcgagaaacagaagcagatgga
atatttgcacctggtggaagtatatccaacctctatggtatattagtagcccgttataag
caatatccagagataaaaagacaaggcatgaccgcactcccgtgcatcgtgttatttgtt
tctgaacaaggtcattattcagtaaaaaaagctgcagcaatccttggtattggaactgac
aatgtaattgaagtaaaatgtgatgaaaggggaaagatgattccagctgagttagagaaa
aacatattacaagctaaaacaaagggccagactcctttctgtgtcacagccacagccggc
accacagtgttcggggccttcgaccctctccacgccatcgccgatatttgtgagacacac
agactctggatgcacgtggacgcagcctggggaggtggattgctgctgtccagaaaccac
gcccataaactcagtggcattgagagggcgaactctgtgacctggaatccacataaactc
atgggtgtcccccttcagtgctctgccatcctgatccgggaaaaaggtcttctggaagca
tgtaaccagatgcgagctggatatcttttccagccagataaaccctacaatgtggacttt
gacactggggataaaactattcagtgtggccgacatgttgatatctttaagctctggtta
atgtggaaagcaaagggaacccgtggctttgaggcacagatcaacagatatatggaactt
gcaacatacttctataagattttgaagaaaaaagataactttaagcttgtgtttgatgca
gagcctgagttcaccaatgtctgcttctggtattttccaccaagacttaaacgtatccca
aaatgttttgaaagagatcaggaactccaaaagattgctccgaagattaaagcacagatg
gtggaggaaggcacagccatgataagcttccagccatgtggggacaaagtaaattttttt
cgaatggttttttctaaccctgccacaagacaagcagatgttgattatcttattgatgaa
attgaaaggcttggaaaggatttatga

DBGET integrated database retrieval system