KEGG   Ursus arctos horribilis: 113241346
Entry
113241346         CDS       T05909                                 

Gene name
EIF2AK2
Definition
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah04141  Protein processing in endoplasmic reticulum
uah04217  Necroptosis
uah05010  Alzheimer disease
uah05160  Hepatitis C
uah05162  Measles
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113241346 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113241346 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113241346 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113241346 (EIF2AK2)
  09172 Infectious disease: viral
   05162 Measles
    113241346 (EIF2AK2)
   05164 Influenza A
    113241346 (EIF2AK2)
   05160 Hepatitis C
    113241346 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    113241346 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113241346 (EIF2AK2)
   05169 Epstein-Barr virus infection
    113241346 (EIF2AK2)
   05165 Human papillomavirus infection
    113241346 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113241346 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113241346 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113241346 (EIF2AK2)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113241346 (EIF2AK2)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   113241346 (EIF2AK2)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113241346 (EIF2AK2)
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     113241346 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm DND1_DSRM Kdo APH ABC1 Prophage_tailD1 Kinase-like DUF2460 Bac_small_YrzI Pkinase_fungal
Other DBs
NCBI-GeneID: 113241346
NCBI-ProteinID: XP_026334752
UniProt: A0A3Q7VA95
LinkDB
Position
Unknown
AA seq 542 aa
MASERPPSFSIEELNTYCQKHSLVLKYYELSKEGPAHNLKFTFQVTINERKYSEAEGKSK
KEAKNAAAKLALEKLNEESKAVSPLSVPTTDASEGVGVGSTENFIGRLNRLAQKEKLSVN
YERCELKEYGPERFYYRCKIGQKEYAVGGGATKQDAKQMAAKFAYDQIQSEKNSMKDDSV
SNDSWASSPSDSGNNTLVKSIFASRSPLENDISPNAPEGNCNSNSVNNSSSPLSNVRSSE
KRVKRSLAPTFNSPVTKENKYTVEVRFASDFTEITPIGSGGYGQVFKAKHKIDGKTYVIK
RVKYDKDKKVEREVKALAALRHPNIVHYCSCWAGEDYDPEDSINPSRPKIKCLLIQMEFC
DKGTLEAWIDNRRGKKPDKPLSLELYEQIAAGVEYIHNQQLIHRDLKPGNIFLVNTKHIK
IGDFGLVTSSKDYENRTSNKGTLRYMSPEQISSKEYGKEVDIFALGLILAELLYICPTLS
ETVEIFKELRAGKFSDVFDAREKILLKRLLSHDPMKRPSASEILETLKMWKNVVVKNERS
TR
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggccagtgagcgtccaccaagcttttctatagaagaacttaatacgtactgtcagaag
cacagtttggtacttaagtattatgaactgtctaaagaaggacctgcgcataacttaaag
tttacatttcaagttaccataaatgagagaaaatattcagaagctgagggtaaatcaaag
aaggaggccaaaaatgctgcagccaaactagctcttgaaaaacttaatgaagaaagcaag
gcagttagtcctttatcagtgccaacaacggatgcttcagaaggagtcggagtagggtcc
actgagaacttcataggccgtttgaataggcttgcccagaaggaaaaactctccgtaaat
tatgaacgatgtgaattgaaagaatatgggccagaaagattttattatcgatgcaaaatt
gggcagaaagagtacgcggttggcggaggtgccacaaaacaagacgccaaacagatggcc
gctaaatttgcatatgatcagatacagtcagagaaaaactcaatgaaagatgactcagta
tcaaatgattcttgggcatcttcgcctagcgactctggaaacaacactttggtgaaaagc
atatttgcttctagatcacctcttgaaaatgatatctcaccaaatgcaccagaaggaaac
tgtaacagcaacagcgtaaacaattcttcatctcctctgagcaatgtcagaagtagtgaa
aagagggtaaaaagaagtttggcccctacttttaactctcctgtgaccaaagaaaacaag
tacactgtggaagtcaggtttgctagtgattttacagaaataacaccgattggctcaggc
ggatacggtcaggttttcaaagcaaagcacaaaattgatgggaagacttatgttattaaa
cgtgttaaatatgataaagacaagaaggtagagcgtgaagtaaaagctttggcagcgctt
cgtcacccaaatatcgttcactactgtagctgctgggccggggaggattacgatcctgag
gacagcataaatccttcaagaccaaagattaagtgccttctcatccaaatggaattctgt
gataaagggacattggaggcatggattgataacagaagaggcaagaaaccagacaaaccc
ttgtctctggagttatacgaacaaatagcagcaggcgtggagtatatacacaaccaacag
ctaattcacagagaccttaagccaggtaacatatttttagtaaatacaaaacacataaag
attggagactttggacttgtgacatcctcgaaagattatgaaaatcggacaagtaataaa
ggaactcttcgatatatgagcccagagcagatttcttcaaaagaatatggaaaagaagtg
gatatctttgccttggggctaattctcgcagaacttctttacatatgtcccactctttcg
gaaacagtggagatttttaaagagctaagggctggcaagttctcagatgtgtttgacgcc
agagaaaaaattcttctgaagagattactgtcacatgatcccatgaagcgacctagtgca
tctgaaatactggagactttgaagatgtggaagaatgttgtagtgaaaaacgaacgaagc
acacgttag

KEGG   Ursus arctos horribilis: 113242045
Entry
113242045         CDS       T05909                                 

Gene name
EIF2AK4
Definition
(RefSeq) eIF-2-alpha kinase GCN2 isoform X1
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah04140  Autophagy - animal
uah04141  Protein processing in endoplasmic reticulum
uah05160  Hepatitis C
uah05162  Measles
uah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113242045 (EIF2AK4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113242045 (EIF2AK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    113242045 (EIF2AK4)
   05160 Hepatitis C
    113242045 (EIF2AK4)
   05168 Herpes simplex virus 1 infection
    113242045 (EIF2AK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113242045 (EIF2AK4)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113242045 (EIF2AK4)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   113242045 (EIF2AK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like Aldo_ket_red APH
Other DBs
NCBI-GeneID: 113242045
NCBI-ProteinID: XP_026335825
UniProt: A0A3Q7U6E1
LinkDB
Position
Unknown
AA seq 1655 aa
MAGGRGAPGRGRDEPPESYPQRQEHELQALEAIYGADFQDLRPDACKSVNEPPEINLVLY
PQGLTGEEVYVQVDLRVRCPPTYPDVVPEIELKNAKGLSNESVNLLKSHLEKVAKKHRGE
VMIFELADHVQSFLSEHNKPPPKSFHEEMLERRAQEEQRRLLEAKQKVEQEQREILHEIQ
RRKEEIKEERKRKEMAKQERLEIASLSNQDQNSRKDLGGHRPAAVLHGGSPDFVGNGKHR
TNSSGRSRRERQYSICSSEDSPGSCEVLYFSMGSPDQLMVYKGKCIGSDEQLGKLVYNAL
ETATGNFVLLHEWVLRWQKKMGPFLTSQEKEKIDKCKKQIQGAETEFSSLVKLSHPNVVR
YFAMNLKEQDDSIVVDILLEHINGVSLAAHLSHSGPVPVHQLRRYAAQLLSGLEYLHSND
VVHKVLRASNVLVDAEGNVKITDYSISKRLADICKEDVFEQSRVSFSDSALPYKTGKKGD
VWCLGLLLLFLSQGQECGEYPVTIPRDLPADFQDFLKKCVCLDDKERWSAQQLLKHSFIS
PQPKMSLLEQSPEDSGGQDYVETVIPSKQLPSAAFFSETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRHFRRIKGEVTLLSRLHHENIVRYYNAWIERYE
RPVGSGTLPLDSDSDSRPQARDGRASSQPPAHNSGPDGPGSVEAAAPPPILSSVEWSTSG
ERSASARFPAASPGSSSDEDVDDDDDEDEDGGVFRQPFLPASDSDSDIIFEDENSKSQNQ
DEDCNGKSSCHESEPSATVEAVHYLYIQMEYCEKSTLRDTIDQGLYQDTVRLWRLFREIL
DGLAYIHEKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFTADGKQEDSADHLTKSD
PSGHLTGMVGTALYVSPEVQGSSRPTYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQ
LRDPTSPKFPEDFDDGEHTKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHG
VLHHTLANVDGKAYRTMMAQIFSQRISPAIDYTYDSNMPKGFSIRTSKIQQHVCDTIVRI
FKRHGAVQLCTPLLLPQNRQIYEHNEAALFMDHSGMLVMLPFDLRIPFARYVARNNILNL
KRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNSSLPTAEVIYTICEIIQEFPALQER
NYSIYLNHTMLLKAILLHCGIPEDKLSQVCVILYDAVTEKLTRREVEAKFYNLSLSSNSL
CRLYKFIEQKGDLQDLTPAINSLIKQKTGVAQLVKYGLKDLEEIVGLLKKLGIKLQVLVN
LGLVYKVQQHNGVIFQFVAVIRRRQRAVSEILAAGGRYDLLIPQFRGPQALGPIPTAVGV
SIAIDKISAAILNMEEPVTISSCDLLIVSVGQMSMSRAINLTQKLWSAGITAQIMYDWSQ
SQEELQEYCRHHEITYVALVSDKGGSYVKVKSFEKERQTEKHVQESDLIDHVLQKLRTKV
SDERTIRETSDNLAAQNLKGSFSNASGLFEIHGAAVVPIVSVIAPEKLSASTRRRYEIQV
QTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQR
YLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF
NT seq 4968 nt   +upstreamnt  +downstreamnt
atggctgggggccgtggggcccccgggcgcggccgggacgagccgccagagagctacccg
cagcggcaggagcatgagctgcaggctctggaggccatctacggcgccgacttccaggac
ctgcgaccggacgcgtgcaaatcggtcaacgagccccctgaaatcaatttagttctgtac
cctcagggcctgactggtgaagaagtgtacgtgcaagtggatttgagggttagatgccca
ccaacgtacccagacgtagtccctgaaatcgagttaaagaatgccaaaggtctgtcaaat
gaaagtgttaatttgttaaaatcccacctagagaaagtggccaaaaaacatcgcggagag
gtgatgatatttgaactggccgaccacgtgcagtcatttctcagcgagcataacaagccc
cctcccaagtctttccacgaagaaatgctggaaaggcgggctcaggaggagcagcggagg
ctgttggaggccaagcagaaggtggagcaggagcaacgtgaaatccttcatgagattcag
agaagaaaagaagagataaaagaagagagaaaaagaaaagaaatggccaagcaggagcgt
ttggaaattgctagtttgtcaaaccaagatcaaaactctaggaaagacctaggaggacac
agaccagctgccgttctacacggaggctctcccgactttgtgggaaatggtaaacatcgg
accaactcctctggaaggtccaggcgagaacgtcagtattctatatgtagtagcgaagat
tctcctggctcttgcgaagtcctgtatttctctatgggaagtcctgatcagctcatggtt
tacaaagggaaatgcattggcagtgatgagcagcttggaaaattagtttacaatgctctg
gaaacggccactggaaactttgtcttgttgcatgagtgggtccttcggtggcagaaaaaa
atgggtccgttccttaccagtcaagagaaggagaagattgataagtgcaaaaagcagatt
cagggggcagaaacggaattcagctcactggtgaaattgagccatccaaatgtagtacgc
tactttgcaatgaatctgaaagagcaagatgactccatcgtagtggacatcttactggag
cacatcaatggggtctccctcgctgcacacctgagccactcaggccccgtccccgtgcat
cagctccgcaggtacgcagctcagctcttgtcaggcctcgagtatttgcacagcaatgac
gtggtgcacaaggttctgcgggcatcgaatgtcctggtggatgcagagggcaatgtcaag
attacggactacagcatttctaagcgcctggcagacatttgcaaggaggacgtgtttgaa
caaagccgagtgagttttagcgacagtgccctaccttacaaaacgggcaagaaaggggat
gtttggtgtcttggccttctgctcctcttcctcagccaaggacaagaatgtggagagtac
cctgtgaccatccctcgtgacttaccagctgactttcaagattttctgaagaagtgtgtt
tgcttggacgacaaggaaagatggagtgcccagcagttgctgaaacacagctttatcagt
cctcagccgaaaatgtctttattggaacaaagtcctgaagattctggaggacaagactat
gtggagactgttattccgagtaagcagctgcccagtgcagcattcttcagcgagacgcag
agacagttttcccggtatttcatcgagtttgaagaattacagcttctcgggaaaggagcc
tttggagctgtcatcaaggtgcagaacaagctggacggctgctgctacgcggtgaagcgc
atccccatcaacccagccagcaggcatttccgcaggatcaagggcgaggtgacgctgctg
tcgcgcctgcaccacgagaacatcgtacgctactacaacgcctggatcgagagatacgag
cggccggtgggctcggggacgctgcccctggactcggactcggactcacggccccaggca
cgcgacgggcgagcttcgtcccagccgcccgcgcacaacagcggccccgacggcccgggc
agcgtggaggccgccgcgcccccgcccatcctcagctccgtggagtggagcacgtcgggc
gagcgctcggccagcgcccgcttccccgccgccagcccgggctccagcagcgacgaggac
gtcgacgatgacgacgacgaggacgaggacgggggcgtcttccggcaacccttcctaccc
gcttcagattctgacagtgatatcatctttgaagatgagaacagtaagagtcagaatcag
gatgaagactgcaatgggaagagcagttgccatgaaagcgagccatcggccaccgtggaa
gctgtgcactacctgtacatccagatggagtactgtgagaagagcactttgcgtgacacc
attgaccaggggctgtatcaggacaccgtcagactctggaggctttttcgagagattctg
gatggattggcatatatccatgagaaaggaatgattcaccgggatttgaagcctgtcaac
atttttttggattccgatgaccatgtgaaaataggtgattttggtttagcgacagaccat
ctagccttcactgctgacggcaagcaagaagattcggcagatcacttgactaaatcagac
ccttcaggtcatttgactggcatggttggtactgctttatacgtaagcccagaggtccaa
ggaagcagtagacccacgtacaaccagaaagtggatctcttcagcctgggaattatcttc
tttgagatgtcctatcaccccatggtcacagcctcagaaagaatctttgttctcaaccaa
ctcagagatcccacttcgcctaagtttccagaagatttcgatgacggagagcatacaaag
cagaaatccgtcatctcctggctgttgaaccacgatcccgccaagcggcccacagccact
gaactgctcaagagcgagctgctgcccccaccccagatggaggagtccgagctgcacgga
gttctgcaccacaccctggccaacgtggacgggaaggcctaccgcaccatgatggcccag
atcttctcccagcgcatctccccagccatcgactacacctacgacagcaacatgccgaag
ggtttctcgatccgtacgtccaagatacagcaacacgtgtgtgacaccatcgtccgcatt
tttaaaagacacggagctgtccagttgtgtaccccactactgcttccccaaaataggcaa
atatacgagcacaatgaagccgccttattcatggaccacagcgggatgctggtgatgctt
cctttcgacctgcggattccttttgcaagatacgtggcaagaaataatatattgaatttg
aaacgatactgcatagagcgcgtgttcagacctcgcaaattagaccgatttcatcccaaa
gagctgctggaatgtgcgttcgatatcgtcacgtctaccaccaacagctctctgcccact
gccgaagtcatctacacgatctgtgagatcatccaggagttcccggcacttcaggaaagg
aattacagtatttacttgaaccataccatgttactgaaagcaatcctcttacactgtggg
atcccagaagacaaactcagtcaagtctgtgtcatcctgtatgatgctgtgacggaaaag
ctgacgaggagagaagtggaagccaagttttacaatctgtctttgtcgtctaatagtctc
tgtcgactctacaaatttattgagcagaagggagatctgcaagatctaaccccagcaata
aattcattaataaaacagaaaacaggcgttgcccagctggtgaagtacggcttaaaagac
ctagaggagattgttgggctgttgaagaaactcggcatcaagttacaggtcttggtcaat
ttgggcttggtttacaaggtgcagcagcacaacggagtcatcttccagttcgtggcggtc
atcagacggaggcaaagggctgtatctgaaatccttgcagctggcggcagatacgacctg
ctgattccccagtttagaggaccacaggctctgggaccaatccccactgctgtcggggtc
agcatagctatagacaagatctctgcggcgatcctcaacatggaagaacctgtcacaata
agctcttgcgacctcctgatcgtaagtgttggccagatgtccatgtccagggccatcaac
ctcacccagaaactctggtcggcgggaatcacagcacaaatcatgtatgactggtcccag
tcccaagaggagctacaggaatactgcagacatcacgaaatcacctacgtggccctcgtc
tcagacaaaggaggaagctatgtcaaggttaagtcttttgagaaggaaaggcaaacagag
aaacatgtgcaggagtctgatcttatagaccacgttttgcagaaactcagaactaaagtc
agtgatgaaaggactatcagagaaacttctgataatcttgcagcgcaaaatctgaagggc
tccttttctaatgcttcaggtttgtttgaaatccacggagcagcagttgttcccattgtg
agtgtgatagccccagagaagctgtcagccagcactaggaggcggtacgaaattcaggta
caaacacgacttcagacctcccttgccaacttacatcagaaaagcagtgaaattgaaatt
ttggctgtggatctacccaaagaaacaatcttacagtttttatcattagagtgggatgct
gatgaacaggcatttaacacaactgtgaagcagctgctgtcacgcctgccaaagcagaga
tacctcaaattagtctgtgatgaaatttataacatcaaagtagaaaaaaaggtatctgtg
ctattcctgtatagctacagagatgactactaccgaatcttattttaa

KEGG   Ursus arctos horribilis: 113242804
Entry
113242804         CDS       T05909                                 

Gene name
EIF2AK3
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah04137  Mitophagy - animal
uah04140  Autophagy - animal
uah04141  Protein processing in endoplasmic reticulum
uah04210  Apoptosis
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah05010  Alzheimer disease
uah05012  Parkinson disease
uah05160  Hepatitis C
uah05162  Measles
uah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113242804 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113242804 (EIF2AK3)
   04137 Mitophagy - animal
    113242804 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    113242804 (EIF2AK3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113242804 (EIF2AK3)
   05012 Parkinson disease
    113242804 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113242804 (EIF2AK3)
  09172 Infectious disease: viral
   05162 Measles
    113242804 (EIF2AK3)
   05160 Hepatitis C
    113242804 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    113242804 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113242804 (EIF2AK3)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113242804 (EIF2AK3)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   113242804 (EIF2AK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PQQ_2 Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 113242804
NCBI-ProteinID: XP_026336844
UniProt: A0A3Q7V1R9
LinkDB
Position
Unknown
AA seq 1112 aa
MERATRPGPPARALMLLLLGLAAGAVAAGRAPDLPAPKAEAAFGLGAAAAPTSAARVPAA
GAVATAEVTVEDAEAVPAAAVDQEPRDPEPDDEADLRPRGRSLVIISTLDGRIAALDPEN
RGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMETVPFTVESLL
ESSYKFGDDVVLVGGKSLTTYGLSAYTGKVRYICSALGCRQWDNDDMEQEDILLLQRSQK
TVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTLKPSGNKEGSKIISDVEEQEA
AMMDTVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLVKDGKVIPISLFDDTSYAS
NNEVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPTSPKALESVNNEYAL
MPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGYYLP
YYKRERSKRSTQITVRFLDNPNYSKNIRKKDPVLLLHWWKEIVGTILFCIVATTFIVRRL
FHPHPHRQRKESETQCQTETKYDSVSGEAKDNSWNDIKNSGYVSRYLTDFEPVQCMGRGG
FGVVFEARNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLDHPGIVRYFNAWLEAPP
EKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEHIEIIAPSSQRRSFSV
GISCGQTSSSESQFSPLEFSGTDHADTSESVDAACNLRDSCLTDCDVEDGTMDGNDEGHS
FELCPSGASPYERSRERTSSSIVFEDSGCDNASSKEELKTKRLHMGNHCANKLSAFKHSS
SESSSQPSISVSPPRPTTLSLDLTKNTAEKLQPSSPKVYLYIQMQLCRKENLKDWMNSRC
TIAERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTVDDVVKVGDFGLVTEMDQ
DEEEEMVLTPMPAYARHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFGTQ
MERVRVLTDVRNLKFPPLFTQKYPREYVMVQDMLSPSPMERPEATTIIENAVFEDLELPG
KTVLRQRSRSLSSSGTKHSRQSSNSRSPLPSN
NT seq 3339 nt   +upstreamnt  +downstreamnt
atggagcgcgccacccgcccggggccgcccgcgcgggctctgatgctgctgctgctggga
ctggcggcgggcgcggtggccgcggggcgcgcccccgatctccccgcgcctaaggcggag
gcggcgttcggcctgggggcagcggccgctcccacttctgcagcgcgggtgccggctgca
ggggccgtggctacggcagaagtgacggtggaggacgccgaagctgtgccggcggccgct
gtggaccaggagccgcgggacccggaacccgatgacgaggccgacctacggccgcgcggc
agatcattagtgattatcagcactttagacgggcgaattgctgccttggatcctgagaat
cgtggtaaaaaacagtgggatttggacgtgggatccggctccttggtttcatccagcctc
agcaaaccagaggtatttgggaataagatgatcattccttctctggatggagacctcttc
cagtgggaccgggaccgtgagagcatggaaacagttcctttcacagttgaatcacttctt
gaatcttcttataaatttggagatgatgttgttttggttggaggaaagtctctcactaca
tatggactcagtgcatatactggaaaggtgaggtacatctgttcagctttgggttgtcgc
caatgggataatgatgacatggaacaagaagacatcctgcttctgcagcgctcccagaaa
actgttagagctgtcggacctcgcagtggcaacgagaagtggaatttcagtgttggccac
tttgaacttcggtatattccagacatggaaactagagccggatttattgaaagcacctta
aagcccagtgggaacaaagaagggtctaaaattatttcagatgtggaagaacaggaagct
gccatgatggacacagtgataaaggtctcagttgctgactggaaggttatggcgtttagc
aagaagggaggacatctggaatgggaataccagttttgtactcccattgcatctgcttgg
ttagttaaggatggaaaagtcattcccataagtctttttgatgatacaagttatgcatct
aacaatgaagttttagaagatgaagaagacattgtagaagctgcccgaggagccacagaa
aacagcgtttacctgggaatgtacagaggtcagctgtatctgcagtcatcagtcagaatt
tcagaaaagtttcctacaagtcccaaggccttggaatctgtcaataatgaatacgcactt
atgcctttgccaacaatcaaatggaaacccttaattcattctccttccagaactcctgtc
ttggtggggtctgatgaatttgacaaatgtctcagtaacgataagttttctcatgaagag
tacagtaatggcgcgctttcaatcttgcaatacccatatgataatggttattatctacca
tactacaagagggagaggagcaaacggagcacacagatcacagtccgatttctcgataac
ccaaattacagcaagaacattcggaaaaaggatcctgttctcctcttacactggtggaaa
gaaatagttggaactattctgttttgtatcgtagccacaacttttattgtgcgtagactt
ttccatcctcatcctcacagacaaaggaaggaatctgaaactcagtgtcaaactgaaact
aaatatgattctgtcagtggagaagctaaggacaatagctggaatgacataaaaaattct
ggatatgtatcacgctatctaacagactttgaaccagttcagtgcatgggtcgtggcggg
tttggagtcgtctttgaagccagaaacaaagtagatgactgcaattacgctatcaagaga
atccgcctccccaacagggagttggctcgggaaaaggtaatgcgagaagttaaagcctta
gccaagcttgaccatccagggattgttagatatttcaatgcgtggttagaagcaccacca
gagaagtggcaagaaaaaatggatgaaatttggctgaaagatgaaagcacagactggccg
ctcagctctcctagtcccatggatgcaccgtcagttaaaatacgcagaatggatcctttc
tctacaaaggaacatattgaaatcatagctccttcttcacaaaggaggtctttttcagta
gggatttcctgtggccagacgagttcatctgagagccagttctctccgctggaattttcg
ggaacggaccatgcagataccagtgagtccgtggatgcagcgtgcaacctccgggacagc
tgcctcacggactgcgatgtggaagatggtactatggatggcaatgacgagggacactcc
tttgaactttgtccttctggagcttctccttacgaaaggtcaagggagagaacatcctct
tctatagtatttgaagattctggctgtgataacgcgtccagtaaagaagagctcaaaacg
aagcgactgcatatgggcaaccattgtgcgaataaactaagtgctttcaagcattccagt
agcgagtcttcttcccaaccgagtatctctgtctctcctccgagaccgaccactttaagt
ctagatctcaccaaaaacactgcagaaaaactccagcccagctctccgaaggtgtatctt
tacattcagatgcagctgtgcagaaaggaaaacctcaaagactggatgaacagccgctgc
accatagcggagagagagaggagcgtgtgtctgcacatcttcctgcagatcgcagaggcc
gttgagtttctgcacagtaaaggcctcatgcacagggacctcaagccttccaacatattc
tttacagtggacgatgtggtcaaggttggagactttgggttagtgaccgaaatggaccag
gatgaggaagaggagatggttctgaccccgatgccagcctatgccagacacacaggacaa
gtggggaccaaactgtatatgagcccagagcagattcatggaaacaactactctcataaa
gtggacatcttttctttaggcctcattctgtttgaattgctgtacccattcggcactcag
atggagagagtcagggtcttaacagatgtaagaaatctcaaatttccaccactgtttact
cagaaatatcctcgtgagtatgtgatggttcaagacatgctctctccatcccccatggaa
cggccagaagctaccaccatcattgaaaatgctgtatttgaagacctggagcttccagga
aaaacagtactcagacagaggtctcgctccctgagttcatcgggaacaaaacattcaaga
cagtccagcaactcccggagccctttgccaagcaattag

KEGG   Ursus arctos horribilis: 113267934
Entry
113267934         CDS       T05909                                 

Gene name
EIF2AK1
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah04141  Protein processing in endoplasmic reticulum
uah05160  Hepatitis C
uah05162  Measles
uah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113267934 (EIF2AK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    113267934 (EIF2AK1)
   05160 Hepatitis C
    113267934 (EIF2AK1)
   05168 Herpes simplex virus 1 infection
    113267934 (EIF2AK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113267934 (EIF2AK1)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113267934 (EIF2AK1)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   113267934 (EIF2AK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH PKcGMP_CC
Other DBs
NCBI-GeneID: 113267934
NCBI-ProteinID: XP_026372067
UniProt: A0A3Q7Y4Y5
LinkDB
Position
Unknown
AA seq 632 aa
MLGGSSGAREREAEGSGAEALPAPPAIEFPADGSDPKYDESDVPAELQVLKGPLQQPTFP
FAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHH
NRAITHLMRSAKERVRQDPCEDNSHIQKIRSREVAFEAQTSRYLNEFEELAVLGKGGYGR
VYKVRNKLDGQYYAIKKILINGATKTDCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVA
QTQDRVSVQLPSLEVLSDEEEEDDRNPYVQNDESNSSSIIFAEFTSEKEKSSGEAGTDSQ
NNRLVNYGTSLITRDSREFESSSLLQGNDLADLPSGSIIEHQLPLRHHSDLEGNFTSTGE
SSENLSLSGQTEVQFHLMLHIQMQLCELSLWDWIVERNQRGREYVDEAACPYVMASVATK
IFQELVEGVFYIHNMGIVHRDLKPRNIFLHGSDQQVKIGDFGLACTDIIQKNTDWIDSDG
KRMPTHTSRVGTCLYASPEQLGGSEYDAKSDMYSLGVILLELFQPFGTEMERVHVLTGLR
SGQIPESLSKRCPVQAKYIQHLTARNASQRPSAVQLLQSELFQNSGNVNLTLQMKILEQE
KEIEELRKQLSLLSQDRGAEGDMRDGGVPVLP
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgctgggaggcagctccggggcccgggagcgcgaggcggagggcagcggggcagaggct
ttgcctgcgccgcccgccatcgagttcccggccgacggctcggaccccaagtatgatgaa
tccgatgtcccagcagaactccaggtattaaaaggacccctacagcagccgactttccct
tttgcagttgcaaaccaactcttgcttgtctctttgctggagcacttgagccatgtgcac
gagccaaaccctctccgttcaagacaggtgtttaaattgctctgccagacctttatcaaa
atggggctgctgtcttctttcacctgtagtgatgagtttagctcgttgagactacaccac
aacagagctattactcatttaatgaggtctgctaaagagagagttcgtcaggatccttgt
gaggataattctcatatccagaagatcagatcgagggaagtagcctttgaagcacagact
tcacggtacctaaatgagtttgaagagcttgccgtcttaggaaaaggcggatacggaaga
gtgtacaaggtcaggaataaattagatggtcagtattatgcaattaaaaaaatcctgatt
aatggcgcaactaaaacagattgtatgaaggtactgcgggaggtgaaggtgctggcaggc
cttcagcaccctaatatcgtaggctatcacactgcttggatcgaacacgttcacgtggcg
caaacacaagatagagtttctgttcagctgccatctctggaagtgctctccgacgaggag
gaggaggacgaccgaaatccgtatgttcaaaatgatgaaagtaacagctcatccattatc
ttcgccgagttcacctcagaaaaagaaaagtcctcaggagaagctggcactgacagtcag
aataacagattggtgaactatggcaccagtttaatcacaagagattccagggaatttgaa
tcatccagtttgctccaaggaaatgatttggctgatttgccttccggatcgatcattgaa
catcagctgccacttaggcatcattccgacttagaagggaatttcacatccaccggggaa
tcttctgaaaacttaagtttgtcggggcagacagaggtgcagttccacctgatgctgcac
atccagatgcagctgtgcgagctctcgctgtgggactggatagtcgagagaaaccagcgg
ggccgggagtacgtggacgaagcggcatgtccttatgtcatggccagtgttgcaacaaaa
atttttcaagaattggtggaaggtgtattttacatccataacatgggaattgtacataga
gatctgaagcccagaaatatttttcttcatggctccgatcagcaagtaaaaataggagac
tttggtctggcctgcacggacatcatacagaagaacacagactggatcgatagcgatggg
aagaggatgcccacacacacttcgagagtgggtacgtgcctgtacgcgtcaccggagcag
ttgggaggatccgagtatgacgccaagtcagacatgtacagcttgggtgtgatcctgcta
gagctctttcagccgtttggaacagaaatggagcgagtacacgttttaacaggtttaaga
agcggtcagatacctgaatccctcagcaagaggtgtcccgtgcaagccaagtatatccag
cacttaactgcaaggaacgcatctcagagaccgtctgctgttcagctgctgcaaagcgaa
cttttccaaaattctggaaatgttaatctcaccctacagatgaaaatactggagcaagaa
aaagaaatcgaagaactaaggaagcagctgagtctcctttctcaggacagaggggccgag
ggtgacatgagagatgggggtgtgcctgtcctgccttaa

DBGET integrated database retrieval system