KEGG   Ursus arctos horribilis: 113241493
Entry
113241493         CDS       T05909                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb isoform X1
  KO
K07208  Ras homolog enriched in brain
Organism
uah  Ursus arctos horribilis
Pathway
uah04072  Phospholipase D signaling pathway
uah04140  Autophagy - animal
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04152  AMPK signaling pathway
uah04211  Longevity regulating pathway
uah04218  Cellular senescence
uah04714  Thermogenesis
uah04910  Insulin signaling pathway
uah04919  Thyroid hormone signaling pathway
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05168  Herpes simplex virus 1 infection
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    113241493 (RHEB)
   04151 PI3K-Akt signaling pathway
    113241493 (RHEB)
   04152 AMPK signaling pathway
    113241493 (RHEB)
   04150 mTOR signaling pathway
    113241493 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113241493 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    113241493 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113241493 (RHEB)
   04919 Thyroid hormone signaling pathway
    113241493 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    113241493 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    113241493 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    113241493 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    113241493 (RHEB)
   05163 Human cytomegalovirus infection
    113241493 (RHEB)
   05165 Human papillomavirus infection
    113241493 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:uah04031]
    113241493 (RHEB)
GTP-binding proteins [BR:uah04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    113241493 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Other DBs
NCBI-GeneID: 113241493
NCBI-ProteinID: XP_026334970
UniProt: A0A3Q7U3X0
LinkDB
Position
Unknown
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcagttcgttgaaggccaatttgttgactcctacgacccaaccatagaa
aacactttcacaaaattgatcacagtcaatggacaagaatatcatcttcaacttgtcgac
acagctgggcaagatgaatactccatctttcctcagacatactccatagatattaatggt
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttattcat
ggaaaattgttggatatggtggggaaagtgcaaatacctattatgttggttgggaataag
aaagacctccacatggaaagggtgatcagttatgaagaagggaaagcattagcagagtct
tggaacgcagcttttttggaatcttctgctaaagaaaatcagacggctgttgatgttttt
agaaggataattttggaggcagaaaaaattgatggggccgcttcacaagggaagtcttcc
tgctcggtgatgtaa

DBGET integrated database retrieval system