KEGG   Ursus arctos horribilis: 113241507
Entry
113241507         CDS       T05909                                 

Gene name
ACTR3B
Definition
(RefSeq) actin-related protein 3B isoform X1
  KO
K18584  actin-related protein 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04530  Tight junction
uah05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    113241507 (ACTR3B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113241507 (ACTR3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113241507 (ACTR3B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113241507 (ACTR3B)
   04147 Exosome [BR:uah04147]
    113241507 (ACTR3B)
Membrane trafficking [BR:uah04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    113241507 (ACTR3B)
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     113241507 (ACTR3B)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113241507 (ACTR3B)
  Exosomal proteins of other body fluids (saliva and urine)
   113241507 (ACTR3B)
  Exosomal proteins of bladder cancer cells
   113241507 (ACTR3B)
SSDB
Motif
Pfam: Actin MreB_Mbl KilA-N
Other DBs
NCBI-GeneID: 113241507
NCBI-ProteinID: XP_026334987
UniProt: A0A3Q7VAY3
LinkDB
Position
Unknown
AA seq 449 aa
MAGSLPPCVVDCGTGCWLLMQSLLPQYRYSSHAHLKSDCVKSEGSRYTKLGYAGNTEPQF
IIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKPTYATKWPIRHGIIEDWDLM
ERFMEQVIFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLAL
AASWTSRQVGERTLTGIVIDSGDGVTHAIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLR
EREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFII
DVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFR
DFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVITHHMQRYAVWFGGSMLASTPE
FFQVCHTKKDYEEYGPSICRHNPVFGVMS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggcgggctccctgcctccctgcgtggtggactgcggcaccggttgctggctccttatg
cagtcccttctcccacaatatcggtattcatcccatgcccacctgaagtctgattgtgtc
aagagtgaaggcagcaggtacaccaagcttggctacgcaggcaacactgagccacagttc
attatcccttcatgtattgccatcagagagtcggcaaaggtagttgatcaagcccaaagg
agggtgttgaggggagtcgatgacctggactttttcattggggatgaggccatagataag
cccacatacgccacgaagtggccaataagacatggaataattgaagactgggatcttatg
gaaaggttcatggaacaagtgatttttaagtatcttcgagctgaacctgaggatcattac
tttttaatgacagagcctccactgaatacgccagaaaacagagaatatcttgcggaaatt
atgtttgaatcatttaatgtaccaggactctacattgcggttcaggcagtgctggcctta
gctgcttcttggacatcccgacaagttggtgaacgtacgttaacggggatcgtcattgac
agcggggatggggtcactcacgctatcccagtggcagaaggttatgtcattggaagctgc
atcaaacacatcccgattgcaggtagagatattacgtatttcattcagcagctgctaagg
gagagggaggtgggaatccctcctgagcaatcactggagaccgcaaaagccattaaggag
aaatactgttatatttgccctgatatagtcaaggaatttgccaagtacgatgtggatccc
cggaagtggatcaaacagtacacaggtatcaatgcaatcaaccagaagaagttcattata
gatgttggctatgaaagattcctgggacctgaaattttctttcacccagagtttgccaac
ccagattttatggaatccatctcagatgtcgttgatgaagtaatacagaactgccccatc
gatgtgcgccgtccgctgtataagaatgtcgttctttcaggaggctcgacgatgttcagg
gactttgggcgtcgactgcagagagatctgaaacgagtggtagatgccagactgagactc
agcgaagagctcagcggaggccggatcaagccgaagcctgtggaggttcaggtgataacg
catcacatgcagcgctacgccgtgtggttcggcggttccatgcttgcctcaacgcccgag
ttcttccaggtctgtcacaccaagaaggactacgaggagtatggccccagcatctgccgc
cacaaccccgtcttcggagtcatgtcttag

KEGG   Ursus arctos horribilis: 113244810
Entry
113244810         CDS       T05909                                 

Gene name
ACTR2
Definition
(RefSeq) actin-related protein 2
  KO
K17260  actin-related protein 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04530  Tight junction
uah05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    113244810 (ACTR2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113244810 (ACTR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113244810 (ACTR2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113244810 (ACTR2)
   04147 Exosome [BR:uah04147]
    113244810 (ACTR2)
Membrane trafficking [BR:uah04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    113244810 (ACTR2)
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     113244810 (ACTR2)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113244810 (ACTR2)
  Exosomal proteins of other body fluids (saliva and urine)
   113244810 (ACTR2)
  Exosomal proteins of bladder cancer cells
   113244810 (ACTR2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 113244810
NCBI-ProteinID: XP_026340254
UniProt: A0A3Q7VBA7
LinkDB
Position
Unknown
AA seq 394 aa
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE
ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR
EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTR
RLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAV
LADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggacagccagggcaggaaggtggtggtgtgcgacaacggcacggggtttgtgaagtgt
ggatatgcaggctctaactttccagaacacatcttcccagctttggttggaagacctatt
atcagatcaaccaccaaagtgggaaacattgaaatcaaggatcttatggtcggtgatgag
gcaagtgaattacgctcaatgttagaagttaactaccctatggaaaatggcatagtacga
aattgggatgacatgaaacacctgtgggattatacatttggaccagagaaacttaacata
gataccagaaactgtaaaatcttactcacagaacctcccatgaacccaaccaaaaacaga
gagaagattgtagaggtaatgtttgaaacttaccagttttctggcgtgtatgttgctatc
caggcagttctgactttgtatgctcaaggtttattgactggagtagtggtggactctgga
gatggtgtaactcacatttgtccagtgtatgaaggcttttctctccctcaccttaccagg
agactggatattgctggaagggatattaccagatatcttatcaagctgctgcttttgcga
ggatatgccttcaaccattctgctgactttgaaacagttcgcatgattaaagaaaaattg
tgctatgtggggtataatattgagcaagagcagaagctggccttagaaaccacagtatta
gttgaatcttacacactcccagatggccgcattatcaaagttgggggagagagatttgaa
gcaccagaagctttatttcagcctcacttgatcaatgttgagggagtaggtgttgctgaa
ttgctttttaacacaatccaggcagctgacattgataccagatctgaattctataagcac
atcgtgctttctggaggatctactatgtaccctgggctgccatcacgactggaacgagaa
cttaagcagctttacttagaacgagttttaaagggagatgtggaaaaactttctaaattt
aagatccgcatcgaagacccaccgcgcagaaagcatatggtgttcctgggtggcgccgtt
cttgcagacatcatgaaagacaaagacaacttctggatgacccgacaagaataccaagag
aagggtgttcgtgtgctggagaaacttggcgtgactgttcgataa

KEGG   Ursus arctos horribilis: 113263434
Entry
113263434         CDS       T05909                                 

Gene name
ACTR3
Definition
(RefSeq) actin-related protein 3
  KO
K18584  actin-related protein 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04530  Tight junction
uah05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    113263434 (ACTR3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113263434 (ACTR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113263434 (ACTR3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113263434 (ACTR3)
   04147 Exosome [BR:uah04147]
    113263434 (ACTR3)
Membrane trafficking [BR:uah04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    113263434 (ACTR3)
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     113263434 (ACTR3)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113263434 (ACTR3)
  Exosomal proteins of other body fluids (saliva and urine)
   113263434 (ACTR3)
  Exosomal proteins of bladder cancer cells
   113263434 (ACTR3)
SSDB
Motif
Pfam: Actin MreB_Mbl ALP_N FtsA Robl_LC7
Other DBs
NCBI-GeneID: 113263434
NCBI-ProteinID: XP_026365899
UniProt: A0A3Q7XHP0
LinkDB
Position
Unknown
AA seq 418 aa
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVK
EFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcgggacggctgccggcctgtgtggtggactgtggcacggggtatacaaaactagga
tatgctggaaacacagaaccacagtttatcatcccttcctgtattgctattaaggagtcc
gcaaaagtgggtgatcaagctcaaaggagggtgatgaaaggtgttgatgacctagacttc
tttattggtgatgaagcaatagaaaaacctacgtatgcaacaaagtggccaattcgccat
ggtatagttgaagattgggacttgatggaaaggtttatggaacaagtgatctttaaatat
ttaagggcagaaccagaagaccattattttcttttgactgaacctccactgaatactcca
gaaaacagggaatatactgctgaaataatgtttgagtccttcaatgttccaggcttgtac
attgctgtgcaggctgttcttgccttagctgcatcctggacctcaagacaagtaggagaa
cggacattgaccggtacagtaatagacagtggagatggtgtcactcatgtcattcctgtg
gctgaagggtatgtgattggcagctgtattaagcacattccaatagcaggacgagatata
acatattttattcagcagttgctgagagaccgagaagtaggaatccctccggagcaatcc
ttggaaactgctaaggcagtaaaggagcgctatagttacgtctgcccagatttagtaaaa
gaatttaacaagtatgacacagatggatcaaagtggattaagcaatataccggaatcaat
gctatctcaaagaaagaattttctattgatgttgggtatgagagattcttgggacctgaa
atcttttttcatccagagtttgctaatccagactttactcaacctatctcagaagttgta
gatgaagtaattcagaattgccctattgatgtcagacgtcctctctacaagaatattgtc
ctctctggaggttcaaccatgttcagggactttggacgtcgcttgcaaagagatttgaaa
agaactgtagatgccaggctgaaattaagtgaggaattgagtggtggcagattgaagcca
aaacctattgatgtacaagtcattacacaccacatgcagcgatatgcagtttggtttgga
ggatcgatgctggcttccacgcctgagttctaccaagtatgccacaccaaaaaggattat
gaagaaattggacctagcatttgtcgtcacaatccagtgtttggagtcatgtcgtaa

DBGET integrated database retrieval system