KEGG   Ursus arctos horribilis: 113241529
Entry
113241529         CDS       T05909                                 

Gene name
PTPRN2
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase N2
  KO
K07817  receptor-type tyrosine-protein phosphatase N [EC:3.1.3.48]
Organism
uah  Ursus arctos horribilis
Pathway
uah04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:uah00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113241529 (PTPRN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113241529 (PTPRN2)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     113241529 (PTPRN2)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    113241529 (PTPRN2)
SSDB
Motif
Pfam: Y_phosphatase Receptor_IA-2 RESP18 DSPc
Other DBs
NCBI-GeneID: 113241529
NCBI-ProteinID: XP_026335013
UniProt: A0A3Q7UFS3
LinkDB
Position
Unknown
AA seq 1002 aa
MSSSFQMILEGEGVDGAICLTVSAASMYGVGCLFEHGLCRPSETCVNDGVFGRCQKVPAI
DIYRYEVSPVGLQHLTATLQKLSRTGFTWQDDYTQHVMAQELSNLPHAYPRHLEASDTAR
TSKLSVDKDRRYSLQEDSALAKAVQRYLPYLQALSQAAAPNMRPRTRPDTPAAQGEDPRA
DGVLTFMAQTSALTYAPGPRADHPGGRPLRTHSRLQPDELSPKVDGGADRQSLVAALGAS
TAPKPPAPHGEGDPGPRNPLRAPWKTARILSAPEALRKWPSPPGDLEDPPALDDEALIQS
LLKDLGKQPAHVEGLSPLDLGEMAHAIATAVQGVGAQGELQGAEKGAAGKPGEASVGKQG
ADGMADGRGPRGEGGVDEEVSRLSLELGDHLQDPGSRLFPATPLLMEPFKMEMKKSETPE
MPPTWEEESAGVEDVRSQTYSKERLERLPPAEPKLGGFGKFQTWVPGPSQEDAHLAAGAR
ERPGEGLRLEVRPSQEEQGYIVTGNDPLSPEEGKELLQSVARLLEVPMSVFADVAVLGPA
VTFRVSSSAPNLTTADVVQAAVDNKDKLEKASGLKILHAGSGSKSKLKLLPHGAEQEDST
PFIVLTLVSVMAMVGVLLASGVIYCLRHTSASRLQDKLSGLGDHPGPDATAAYQELCRQR
MAVRTSDRPEAPHASRINSVSSQFSDGPMPSPSARSSTSSWSEEPVQSNMDISTGHMVLA
YMEDHLKNKNRLEKEWEALCVYQAEPNSSLVAQREENVPKNRSPAVLTYDHSRVLLKSEN
SHSNSDYINASPIMDHDPRSPAYIATQGPLPATVADFWQMVWESGCVVIVMLTPLSENGV
RQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYD
QGVPSSARSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEID
IAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILRALPQ
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgagttcaagcttccagatgattctggaaggggagggtgtggatggtgccatttgcctt
acggtgtcagctgccagcatgtatggagtaggctgtttgtttgagcatggcctctgcaga
ccgtctgagacctgtgtcaacgatggagtgtttggaaggtgccagaaggttccagcgata
gacatataccgctatgaagtgtcgccggtgggtctgcagcacctgacagccaccttgcag
aagctgtcccgcacaggcttcacatggcaggacgactacacccagcatgtgatggcccag
gaactctcaaaccttccccacgcctacccacgacatctggaggcttccgacacagccagg
acctcaaagctgagtgtggataaggacaggaggtacagtctgcaggaggacagcgccctg
gccaaggctgttcagcgctacctgccgtacctgcaggccctgtcccaggctgctgctccg
aacatgcgccccaggacaaggcccgacacaccagcagctcagggtgaggacccccgtgcc
gacggcgtgctgaccttcatggcacagacatccgctctgacctacgctcctgggccccgg
gccgaccatcccgggggccgccctttgcggacccacagccggctgcagcctgacgagctc
agccccaaggtggacggcggtgccgacaggcagagcctggttgctgcgctgggtgcctct
acggctccgaagcccccagcgccccacggggagggtgacccagggcctcgaaacccgctg
cgggcgccctggaaaacagcaagaatactttcggccccagaggccctccggaaatggcct
tcacctccaggagaccttgaggaccccccggccttggatgatgaagcactcatccagagt
ctcctgaaggacctgggaaagcagccggcgcacgtggagggtctgagccccctggacctc
ggggagatggcccacgcgattgctaccgccgtgcagggtgtgggtgcacaaggggagctt
caaggagccgagaaaggagctgcaggaaagccaggagaggccagcgttggcaagcagggt
gcagacggcatggcagatggcagagggccgcgcggcgaaggtggagttgacgaagaggtc
agtcgtttgagcctcgaactcggggaccacctgcaagatcctgggtcccgactctttcct
gccaccccacttcttatggagcccttcaaaatggagatgaagaagtcagagacccccgag
atgcccccgacttgggaggaggagagcgctggagtggaggacgtgaggagtcagacctac
tccaaggagcggctggagaggctgcctcccgcagagcccaagttgggtggctttggcaaa
ttccagacctgggttccggggccctcacaggaagatgcccaccttgcagccggagcccgg
gaacgccctggtgaaggcctgcggctggaggtcaggccttcccaggaggagcaaggctac
atcgtgaccgggaacgaccccctgagcccagaagaggggaaggagctgttgcagagcgtt
gcgcgtctcctggaggtgccgatgagtgtcttcgcagacgtcgctgtcctgggaccagcc
gtgaccttcagagtgagctccagcgccccaaacctgacgacggcagacgtggtgcaggct
gcagttgacaacaaggacaaactggaaaaagcgtctggactgaaaattcttcacgctgga
agcgggtcgaaaagcaaactcaagctcctgccacacggagcagagcaagaggactcaacc
ccgttcatcgtgctgaccctggtctctgtcatggctatggtcggggtcctcctggcctcc
ggtgtcatctactgtctgcgccacacctccgcctccaggctgcaggataagctctccggc
ctgggggaccaccccggcccagatgccactgccgcctaccaggagctgtgccggcaacgc
atggccgtgcgcacgtcggaccgcccggaggccccgcacgcgtcccgcatcaacagcgtc
tcatcccagttcagcgacgggccgatgccaagcccgtctgcacggagcagcacatcgtcc
tggtctgaggagcccgtgcagtccaacatggacatctccaccggccacatggtcctggcc
tacatggaagaccacttgaagaacaagaaccggctagagaaggagtgggaggcgctgtgt
gtctaccaggccgagcccaacagctcgctcgtggcccagagggaggagaacgtgccaaag
aaccgctctccggctgtgctgacctacgatcactccagggtcctgctgaaatccgagaac
agccatagcaactcggactacatcaacgccagccccatcatggatcacgaccctaggagt
cccgcctacatcgccacccaggggcccctgcccgccaccgtggccgacttctggcagatg
gtgtgggagagtggctgcgtggtcatcgtcatgctgacgcccctctcggagaacggcgtc
cggcaatgctaccactactggccagacgaaggctccaacctctaccacatctacgaggta
aacctagtctccgagcatatctggtgcgaggatttcctcgtgaggagcttctatctgaag
aaccttcaaaccaacgagacgcgcaccgtgacccagttccacttcctgagctggtatgac
cagggagtgccttcctccgccaggtccctcctggatttccgcagaaaagtaaacaagtgc
tacaggggccgttcttgtccaataattgttcactgcagcgacggcgcgggcaggagcggc
acctacgtcctgatcgacatggttctcaacaagatggccaaaggtgcaaaggagattgat
atcgcagcgaccctggagcacctgagggaccagagaccgggcatggtgcagacaaaggag
cagttcgagtttgcgctgacggcggtggcagaagaggtgaacgccatcctcagggccctc
ccgcagtga

KEGG   Ursus arctos horribilis: 113250429
Entry
113250429         CDS       T05909                                 

Gene name
PTPRN
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase-like N isoform X1
  KO
K07817  receptor-type tyrosine-protein phosphatase N [EC:3.1.3.48]
Organism
uah  Ursus arctos horribilis
Pathway
uah04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:uah00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113250429 (PTPRN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113250429 (PTPRN)
Enzymes [BR:uah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     113250429 (PTPRN)
Protein phosphatases and associated proteins [BR:uah01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    113250429 (PTPRN)
SSDB
Motif
Pfam: Y_phosphatase Receptor_IA-2 RESP18 DSPc Epiglycanin_C Y_phosphatase3
Other DBs
NCBI-GeneID: 113250429
NCBI-ProteinID: XP_026347655
UniProt: A0A3Q7V6D6
LinkDB
Position
Unknown
AA seq 890 aa
MSQGLSWHDDLTQYVISQEMERIPRLHPPEPRPRDRSGLVPRRPGPAGELLLQGIPTGST
PAAQHRLPQPPVGGGGAGVGSPLSPLQAELLPPLLEHLLLPPQAPHPALSYEPALLQPYL
FHQFGSRDGSRGSEGSPGMVSVGPLPKAEPSTPFSRTASKGMFGAHSDHSYGDPPGPSPG
QLFQESGLLYLAQELPVPSRARAPRLPEQGGSSRAKDSSEGYEEEGLEGRREKPPSSAEQ
PADVTLQRLAAVLAGYGVELRQLTPEQLSTLSTLLQLLPKGAARNLGGVGNVGADVKKTV
EERVQGENTAEPPAPTPSLPGYPTASPTSSKAQEVLSSGSSKPPKAANHLDAPVLLEKKS
PLGQSQPTVVRQPSAQPLAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHVSSGSFINISV
VGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPRPAH
STSPMRSVLLTLVALAGVAGLLVALAVALCVRQHARQRDKERLAALGPEGAHGDTTFEYQ
DLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDI
STGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHA
RIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVML
TPLVEDGVKQCDRYWPDEGSSLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQ
FHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPVVVHCSDGAGRTGTYILIDMVLNRM
AKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKALPQ
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgtcccaaggattgtcctggcatgatgacctcacccagtatgtgatctcccaggagatg
gaacgcatccctaggcttcaccccccagagccccgtccaagggacagatctggcttggtg
cccaggagacctggtcccgctggggagctgcttttacagggcatccctactggctccacc
cctgcagcccagcaccggcttcctcaacctccagtgggtgggggtggagctggggtgggc
tctccactctcccctctgcaggctgaactgctgccccctctcttggagcacctgctgcta
cccccgcaggccccccaccctgctctgagttatgaacctgccctgctgcagccctacttg
ttccatcagtttggctcccgcgatggctcccggggctcagagggctctccagggatggtc
agtgtcggccccctgcccaaagccgaaccctctactcccttcagcagaactgcctccaaa
ggcatgtttggggctcactctgaccactcctatggggaccctccagggccttcccctggt
caacttttccaggagtcagggcttctctacctggcccaggagctgccagtgcccagcagg
gccagggcaccaaggctgccagagcaagggggcagcagccgggcaaaggactcctcagag
ggctatgaggaggaagggctagaaggtcgcagggagaaacccccttcttcagcagagcag
ccagcagacgtgactctgcagagactggcagcggtgctggcgggctatggggtagagctg
cgtcagctgacccctgagcagctctccaccctctcaaccctgctgcagctactgcccaag
ggcgcagcacgaaatctgggaggggttggaaatgttggagctgacgtcaagaaaacagtg
gaggagcgggtgcagggtgaaaacacggcggagcctccagcccccacgccctccctgcct
ggataccccactgccagccccacttccagtaaagcccaggaggtgctgagctctggatcc
tccaagccccccaaagctgctaaccaccttgacgcgcctgtcctgctagagaagaaaagt
ccactgggccagagccagcccacagtggtgaggcagccatcagcccagccattggcagag
gagtatggctacattgtcactgaccagaagcccctgagtctggctgcaggagtgaagctg
ctggagatcctagctgagcacgtgcacgtgtcctcgggcagcttcatcaacatcagtgtg
gtgggaccggccctcaccttccgcatccgacacaatgaacagaacctgtctttggctgat
gtgacccagcaagccgggctggtgaagtcggaactggaagcacagacagggctccagatc
ttgcagacaggagtgggacagagggaggaagcagctgcagtccttccccgaccagcccac
agcacctctcccatgcgctcagtgctactcactctggtggccctggcaggtgtggccggg
ctgctggtggctttggcagtggctttgtgtgtgcggcagcatgcacggcagcgggacaag
gagcgcctggcagccctagggcccgagggggcccatggtgacactacctttgagtaccag
gacctgtgccgccagcacatggccacaaagtctctgttcaaccgggcagagggtccgccg
gagccttctcgggtgagcagcgtgtcctcccagtttagtgacgcagcccaggccagcccc
agctcccacagcagcacaccgtcctggtgcgaggagcccgcccaggccaacatggacatc
tccacgggacacatgattctggcgtacatggaggaccacctgcggaaccgggaccgcttg
gccaaggagtggcaggccctgtgtgcctaccaggcagagcccaacacctgtgccacggcc
cagggggagggcaacatcaaaaagaaccgccatcctgacttcctgccctatgatcacgct
cgcatcaagctgaaggtggagagcagcccttctcggagtgattacatcaacgccagcccc
attattgagcatgaccctcggatgccagcctacatagccacacagggcccactgtcccat
accatcgcagacttctggcagatggtgtgggagagtggctgcaccgtcatcgtcatgctg
accccgctggtggaggatggtgtcaagcagtgtgaccgctactggccagatgaggggtcc
tccctctaccacgtatatgaggtgaacctggtgtcggagcacatctggtgcgaggacttc
ctggtgcgcagcttctacctgaagaacgtgcagacgcaggagacgcgcacgctcacgcag
ttccacttcctcagctggccggcagagggcactccggcgtccacccggccgctgctggac
ttccgcaggaaagtgaacaagtgctaccggggccgctcctgccccgtcgttgtgcactgc
agcgatggtgcggggaggactggcacttacatcctcattgacatggtactgaaccgcatg
gcaaaaggagtaaaggagatcgacatcgctgccaccctggagcatgtccgtgaccagcgg
cctggcctcgtccgctctaaggaccagtttgaatttgctctgacagccgtggcggaggag
gtgaatgccatcctcaaggctctgccccagtga

DBGET integrated database retrieval system