KEGG   Ursus arctos horribilis: 113241613
Entry
113241613         CDS       T05909                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04015  Rap1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04114  Oocyte meiosis
uah04218  Cellular senescence
uah04261  Adrenergic signaling in cardiomyocytes
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04714  Thermogenesis
uah04722  Neurotrophin signaling pathway
uah04723  Retrograde endocannabinoid signaling
uah04728  Dopaminergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04917  Prolactin signaling pathway
uah04926  Relaxin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05205  Proteoglycans in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113241613 (MAPK11)
   04010 MAPK signaling pathway
    113241613 (MAPK11)
   04370 VEGF signaling pathway
    113241613 (MAPK11)
   04668 TNF signaling pathway
    113241613 (MAPK11)
   04068 FoxO signaling pathway
    113241613 (MAPK11)
   04071 Sphingolipid signaling pathway
    113241613 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113241613 (MAPK11)
   04218 Cellular senescence
    113241613 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113241613 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113241613 (MAPK11)
   04620 Toll-like receptor signaling pathway
    113241613 (MAPK11)
   04621 NOD-like receptor signaling pathway
    113241613 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    113241613 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    113241613 (MAPK11)
   04660 T cell receptor signaling pathway
    113241613 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    113241613 (MAPK11)
   04659 Th17 cell differentiation
    113241613 (MAPK11)
   04657 IL-17 signaling pathway
    113241613 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    113241613 (MAPK11)
   04670 Leukocyte transendothelial migration
    113241613 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    113241613 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    113241613 (MAPK11)
   04917 Prolactin signaling pathway
    113241613 (MAPK11)
   04926 Relaxin signaling pathway
    113241613 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    113241613 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113241613 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    113241613 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    113241613 (MAPK11)
   04722 Neurotrophin signaling pathway
    113241613 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113241613 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113241613 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    113241613 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    113241613 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113241613 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    113241613 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113241613 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113241613 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113241613 (MAPK11)
   05135 Yersinia infection
    113241613 (MAPK11)
   05133 Pertussis
    113241613 (MAPK11)
   05152 Tuberculosis
    113241613 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113241613 (MAPK11)
   05161 Hepatitis B
    113241613 (MAPK11)
   05163 Human cytomegalovirus infection
    113241613 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113241613 (MAPK11)
   05169 Epstein-Barr virus infection
    113241613 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113241613 (MAPK11)
   05140 Leishmaniasis
    113241613 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    113241613 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113241613 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113241613 (MAPK11)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113241613 (MAPK11)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113241613 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 113241613
NCBI-ProteinID: XP_026335130
UniProt: A0A3Q7U4D1
LinkDB
Position
Unknown
AA seq 364 aa
MSGPRAGFYRLELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPAEPPQSAGGL
DIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggcccgcgcgcaggcttctaccggctggagctcaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctcggtctgctcg
gcctatgacgcgcggctgcgccagaaggtggcggtgaagaagctgtcgcgacccttccag
tcactgatccacgcgcggaggacttaccgcgagctacggctgctcaagcacctgaagcac
gagaacgtcattgggctgctggacgtgttcacgccggccacctccatcgaggacttcagc
gaagtgtacctggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgtccagttcctggtttaccagttgcttcgcgggctgaagtac
atccactccgcggggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgcgagctcaggatcctggactttgggctagcccgccaggctgatgaggagatgacc
ggctatgtggccactcgctggtaccgggcccccgagatcatgctcaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctccaaggaaag
gccctctttccaggaaatgactacatcgaccagctgaagcgaatcatggaagttgtgggc
acacccagccctgaggttctagcaaagatatcctcagaacacgcccggacatacatccag
tccctgccccctatgccccagaaggacctcaggagcatcttccatggagccaaccccctg
gctgtggacctcctgggaaggatgctggtgcttgacagtgaccagagggtcagtgcggcc
gaggccctggcccatgcctacttcagccagtaccacgaccccgacgatgagcctgaggcc
gagccctacgatgagagcgttgaggccaaggagcgtacagtggaggagtggaaggagctc
acctaccaggaggtcctcagcttcaagcccgcagagccgccgcagtcagccggcggcctg
gacattgagcagtga

KEGG   Ursus arctos horribilis: 113241615
Entry
113241615         CDS       T05909                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04015  Rap1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04114  Oocyte meiosis
uah04218  Cellular senescence
uah04261  Adrenergic signaling in cardiomyocytes
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04714  Thermogenesis
uah04722  Neurotrophin signaling pathway
uah04723  Retrograde endocannabinoid signaling
uah04728  Dopaminergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04917  Prolactin signaling pathway
uah04926  Relaxin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05205  Proteoglycans in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113241615 (MAPK12)
   04010 MAPK signaling pathway
    113241615 (MAPK12)
   04370 VEGF signaling pathway
    113241615 (MAPK12)
   04668 TNF signaling pathway
    113241615 (MAPK12)
   04068 FoxO signaling pathway
    113241615 (MAPK12)
   04071 Sphingolipid signaling pathway
    113241615 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113241615 (MAPK12)
   04218 Cellular senescence
    113241615 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113241615 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113241615 (MAPK12)
   04620 Toll-like receptor signaling pathway
    113241615 (MAPK12)
   04621 NOD-like receptor signaling pathway
    113241615 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    113241615 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    113241615 (MAPK12)
   04660 T cell receptor signaling pathway
    113241615 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    113241615 (MAPK12)
   04659 Th17 cell differentiation
    113241615 (MAPK12)
   04657 IL-17 signaling pathway
    113241615 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    113241615 (MAPK12)
   04670 Leukocyte transendothelial migration
    113241615 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    113241615 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    113241615 (MAPK12)
   04917 Prolactin signaling pathway
    113241615 (MAPK12)
   04926 Relaxin signaling pathway
    113241615 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    113241615 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113241615 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    113241615 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    113241615 (MAPK12)
   04722 Neurotrophin signaling pathway
    113241615 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113241615 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113241615 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    113241615 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    113241615 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113241615 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    113241615 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113241615 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113241615 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113241615 (MAPK12)
   05135 Yersinia infection
    113241615 (MAPK12)
   05133 Pertussis
    113241615 (MAPK12)
   05152 Tuberculosis
    113241615 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113241615 (MAPK12)
   05161 Hepatitis B
    113241615 (MAPK12)
   05163 Human cytomegalovirus infection
    113241615 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113241615 (MAPK12)
   05169 Epstein-Barr virus infection
    113241615 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113241615 (MAPK12)
   05140 Leishmaniasis
    113241615 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    113241615 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113241615 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113241615 (MAPK12)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113241615 (MAPK12)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113241615 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo UvrD_C Kinase-like
Other DBs
NCBI-GeneID: 113241615
NCBI-ProteinID: XP_026335136
UniProt: A0A3Q7TGR0
LinkDB
Position
Unknown
AA seq 367 aa
MSSPPPARRGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSAGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPADFVQRLQSADAKNYMKGLPELEKKDFASILTSASPLAVNLLEKMLVLDAERRV
TAAEALTHPYFESLHDTEDEPKAQKYDESFDDMDRTLDEWKRVTYKEVLSFKPPLQLGTK
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcaggggcttctaccgccaggaggtgaccaagacggct
tgggaggtgcgcgccgtgtaccaggacctgcagcccgtgggctccggcgcctacggcgcg
gtgtgctcggccgtggacagccgcacgggcgccaaggtggccatcaagaagctgtaccgg
cccttccagtcggagctcttcgccaagcgcgcctaccgcgagctgcgtctgctcaagcac
atgcgccacgagaacgtcatcgggctgctggacgtgttcactcctgatgaaaccttggat
gatttcacagacttttacctggtgatgccgttcatggggactgacctaggaaagctcatg
aagcacgagaaactgagcgaggaccgaatccagttccttgtctaccagatgctgaagggg
ctaaagtacattcacgctgctggcgtcatccacagggacctgaagcctggcaacctggcc
gtgaatgaggactgtgagctgaagattctggacttcggcctggcgaggcaggcggacagc
gagatgactgggtatgtggtgacccggtggtaccgggcgcccgaggtcatcttgaactgg
atgcgttacacgcagacagtggacatctggtcagcgggctgcatcatggcggagatgatc
acggggaagacgctgtttaagggcagtgaccacctggaccagctgaaggagatcatgaag
gtgacagggacgcctcccgctgactttgtgcagaggctgcagagtgcggacgcgaagaac
tacatgaagggcctccccgagttggagaagaaggattttgcctccatcctgactagtgca
agccctctggctgtgaacctcctggagaaaatgctggtgctagatgcagagcggcgggtg
acggcggccgaggcgctgacccacccctacttcgagtcactgcatgacacggaggatgag
cccaaggcccagaagtacgatgagtcctttgatgatatggaccgcacgctggacgagtgg
aaacgtgtcacatataaagaagtgctcagcttcaagcctcccctgcagctggggaccaag
gtctccaaggagacggctctgtga

KEGG   Ursus arctos horribilis: 113243852
Entry
113243852         CDS       T05909                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04015  Rap1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04114  Oocyte meiosis
uah04218  Cellular senescence
uah04261  Adrenergic signaling in cardiomyocytes
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04714  Thermogenesis
uah04722  Neurotrophin signaling pathway
uah04723  Retrograde endocannabinoid signaling
uah04728  Dopaminergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04917  Prolactin signaling pathway
uah04926  Relaxin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05205  Proteoglycans in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113243852 (MAPK14)
   04010 MAPK signaling pathway
    113243852 (MAPK14)
   04370 VEGF signaling pathway
    113243852 (MAPK14)
   04668 TNF signaling pathway
    113243852 (MAPK14)
   04068 FoxO signaling pathway
    113243852 (MAPK14)
   04071 Sphingolipid signaling pathway
    113243852 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113243852 (MAPK14)
   04218 Cellular senescence
    113243852 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113243852 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113243852 (MAPK14)
   04620 Toll-like receptor signaling pathway
    113243852 (MAPK14)
   04621 NOD-like receptor signaling pathway
    113243852 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    113243852 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    113243852 (MAPK14)
   04660 T cell receptor signaling pathway
    113243852 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    113243852 (MAPK14)
   04659 Th17 cell differentiation
    113243852 (MAPK14)
   04657 IL-17 signaling pathway
    113243852 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    113243852 (MAPK14)
   04670 Leukocyte transendothelial migration
    113243852 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    113243852 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    113243852 (MAPK14)
   04917 Prolactin signaling pathway
    113243852 (MAPK14)
   04926 Relaxin signaling pathway
    113243852 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    113243852 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113243852 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    113243852 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    113243852 (MAPK14)
   04722 Neurotrophin signaling pathway
    113243852 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113243852 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113243852 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    113243852 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    113243852 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113243852 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    113243852 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113243852 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113243852 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113243852 (MAPK14)
   05135 Yersinia infection
    113243852 (MAPK14)
   05133 Pertussis
    113243852 (MAPK14)
   05152 Tuberculosis
    113243852 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113243852 (MAPK14)
   05161 Hepatitis B
    113243852 (MAPK14)
   05163 Human cytomegalovirus infection
    113243852 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243852 (MAPK14)
   05169 Epstein-Barr virus infection
    113243852 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243852 (MAPK14)
   05140 Leishmaniasis
    113243852 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    113243852 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113243852 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113243852 (MAPK14)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113243852 (MAPK14)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113243852 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH
Other DBs
NCBI-GeneID: 113243852
NCBI-ProteinID: XP_026338525
UniProt: A0A3Q7TR11
LinkDB
Position
Unknown
AA seq 362 aa
MAPCASEEWQILCRHSRNFCASSSRSHSKPSTLIRQHLVASAAFDTKTGLRVAVKKLSRP
FQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK
CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDE
MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRL
VGTPGADLLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRIT
AAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEM
ES
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggctccgtgtgcttctgaagagtggcagatactttgtaggcactcaagaaatttttgt
gccagctcgtcccgaagtcattccaagccctccactctgatcaggcagcatttggtggca
agtgctgcttttgacacaaaaactgggttacgtgtggcagtgaagaagctctccagacca
tttcagtccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatg
aaacatgaaaatgtgattggtctgttggatgtttttacacctgcaaggtctctggaggaa
ttcaatgatgtgtatctggtgacccatctcatgggagcagatctgaacaacattgtgaaa
tgtcagaagcttacagatgaccatgttcagttcctcatctaccagattctccgaggtctc
aagtatatacattcagctgacataattcacagggacctaaaacctagtaatctagctgtg
aatgaagactgtgagctgaagatcttggattttggactggcccgacatacagatgatgaa
atgacaggctatgtggccaccaggtggtacagggctcctgagatcatgctgaactggatg
cattacaaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgact
ggaagaacgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactc
gttggaaccccaggggctgatcttttgaagaaaatctcctcagagtctgcaagaaattac
attcagtctttgacccagatgccgaaaatgaactttgcaaatgtatttattggtgccaat
cccttggctgtcgacttgctggagaagatgcttgtattggactcagacaagagaattaca
gcagcccaagcgctcgcacacgcctactttgctcagtaccacgatcctgatgatgaacca
gtggctgatccttacgatcagtcctttgaaagcagggacctccttatagatgaatggaaa
agcctgacctacgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatg
gaatcctga

KEGG   Ursus arctos horribilis: 113243854
Entry
113243854         CDS       T05909                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
uah  Ursus arctos horribilis
Pathway
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04015  Rap1 signaling pathway
uah04068  FoxO signaling pathway
uah04071  Sphingolipid signaling pathway
uah04114  Oocyte meiosis
uah04218  Cellular senescence
uah04261  Adrenergic signaling in cardiomyocytes
uah04370  VEGF signaling pathway
uah04380  Osteoclast differentiation
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04611  Platelet activation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah04670  Leukocyte transendothelial migration
uah04714  Thermogenesis
uah04722  Neurotrophin signaling pathway
uah04723  Retrograde endocannabinoid signaling
uah04728  Dopaminergic synapse
uah04750  Inflammatory mediator regulation of TRP channels
uah04912  GnRH signaling pathway
uah04914  Progesterone-mediated oocyte maturation
uah04917  Prolactin signaling pathway
uah04926  Relaxin signaling pathway
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah04935  Growth hormone synthesis, secretion and action
uah05014  Amyotrophic lateral sclerosis (ALS)
uah05132  Salmonella infection
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05145  Toxoplasmosis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05205  Proteoglycans in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113243854 (MAPK13)
   04010 MAPK signaling pathway
    113243854 (MAPK13)
   04370 VEGF signaling pathway
    113243854 (MAPK13)
   04668 TNF signaling pathway
    113243854 (MAPK13)
   04068 FoxO signaling pathway
    113243854 (MAPK13)
   04071 Sphingolipid signaling pathway
    113243854 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113243854 (MAPK13)
   04218 Cellular senescence
    113243854 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113243854 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113243854 (MAPK13)
   04620 Toll-like receptor signaling pathway
    113243854 (MAPK13)
   04621 NOD-like receptor signaling pathway
    113243854 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    113243854 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    113243854 (MAPK13)
   04660 T cell receptor signaling pathway
    113243854 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    113243854 (MAPK13)
   04659 Th17 cell differentiation
    113243854 (MAPK13)
   04657 IL-17 signaling pathway
    113243854 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    113243854 (MAPK13)
   04670 Leukocyte transendothelial migration
    113243854 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    113243854 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    113243854 (MAPK13)
   04917 Prolactin signaling pathway
    113243854 (MAPK13)
   04926 Relaxin signaling pathway
    113243854 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    113243854 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113243854 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    113243854 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    113243854 (MAPK13)
   04722 Neurotrophin signaling pathway
    113243854 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113243854 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113243854 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    113243854 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    113243854 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113243854 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    113243854 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113243854 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113243854 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113243854 (MAPK13)
   05135 Yersinia infection
    113243854 (MAPK13)
   05133 Pertussis
    113243854 (MAPK13)
   05152 Tuberculosis
    113243854 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113243854 (MAPK13)
   05161 Hepatitis B
    113243854 (MAPK13)
   05163 Human cytomegalovirus infection
    113243854 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113243854 (MAPK13)
   05169 Epstein-Barr virus infection
    113243854 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243854 (MAPK13)
   05140 Leishmaniasis
    113243854 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    113243854 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113243854 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113243854 (MAPK13)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113243854 (MAPK13)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113243854 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Kdo Kinase-like DUF4023
Other DBs
NCBI-GeneID: 113243854
NCBI-ProteinID: XP_026338531
UniProt: A0A3Q7TR16
LinkDB
Position
Unknown
AA seq 366 aa
MSFTRKKGFYKQDVNKTSWELPKTYVSPTHIGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELRLLKHMQHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLSGKTLFKGKDYLDQLSQILKVTG
VPGAEFVQKLHDKAAKSYIQALPQSPKKDFSQLFPRASPQAIDVLEKMLELDVDKRLTAS
QALAHPFFELFRDPEEETEAPQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPVARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcttcacccggaaaaagggcttctacaagcaggacgtcaacaagaccagctgggag
ctgcccaagacctacgtgtccccgacgcacataggcagcggggcttatggcgccgtgtgc
tccgccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatcttcgccaagcgggcctaccgagagctgcggctgctgaagcacatgcag
catgagaacgtcatcgggctcctggatgtcttcaccccagcctcctccctgcgcagcttc
catgacttctacctggtgatgcccttcatgcagacggacctgcagaagatcatggggatg
gagttcagcgaggacaagatccagtacctggtgtatcagatgcttaaggggctcaagtac
atccactcagctggggtcgtccacagggacctaaagccgggcaacctggctgtgaacgag
gactgcgagctgaagatcttggatttcggcctggcccggcacgcggacgcagagatgacg
ggctacgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcactac
aaccagaccgtggacatctggtctgtgggctgtatcatggcagagatgctatcggggaag
actctgttcaaggggaaagattacctggaccagctgtcccagatcctgaaagtgaccggg
gtgccgggcgcagagtttgtgcagaagttgcacgacaaagcagccaaatcctacatccag
gccctgccacagagccccaagaaggatttctctcagctcttcccgcgcgccagcccccag
gccatagacgtgctggagaagatgctggagctggacgtggacaagcgcctgacggcctcg
caggccctcgcgcaccccttctttgaactcttccgagacccggaggaggagacagaggcc
ccgcagccttttgatgattccctggaacatgagaaactcacagtggatgaatggaagcag
cacatctacaaggagatcgtgaacttcagccccgttgcccggaaggactcacggcgccgg
agcggcatgaagctgcagtga

DBGET integrated database retrieval system