KEGG   Ursus arctos horribilis: 113241630
Entry
113241630         CDS       T05909                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04062  Chemokine signaling pathway
uah04068  FoxO signaling pathway
uah04072  Phospholipase D signaling pathway
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04630  JAK-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04714  Thermogenesis
uah04722  Neurotrophin signaling pathway
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04926  Relaxin signaling pathway
uah04935  Growth hormone synthesis, secretion and action
uah05034  Alcoholism
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113241630 (SOS1)
   04010 MAPK signaling pathway
    113241630 (SOS1)
   04012 ErbB signaling pathway
    113241630 (SOS1)
   04630 JAK-STAT signaling pathway
    113241630 (SOS1)
   04068 FoxO signaling pathway
    113241630 (SOS1)
   04072 Phospholipase D signaling pathway
    113241630 (SOS1)
   04151 PI3K-Akt signaling pathway
    113241630 (SOS1)
   04150 mTOR signaling pathway
    113241630 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113241630 (SOS1)
   04540 Gap junction
    113241630 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113241630 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113241630 (SOS1)
   04660 T cell receptor signaling pathway
    113241630 (SOS1)
   04662 B cell receptor signaling pathway
    113241630 (SOS1)
   04664 Fc epsilon RI signaling pathway
    113241630 (SOS1)
   04062 Chemokine signaling pathway
    113241630 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113241630 (SOS1)
   04912 GnRH signaling pathway
    113241630 (SOS1)
   04915 Estrogen signaling pathway
    113241630 (SOS1)
   04917 Prolactin signaling pathway
    113241630 (SOS1)
   04926 Relaxin signaling pathway
    113241630 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    113241630 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113241630 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    113241630 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113241630 (SOS1)
   05206 MicroRNAs in cancer
    113241630 (SOS1)
   05205 Proteoglycans in cancer
    113241630 (SOS1)
   05231 Choline metabolism in cancer
    113241630 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113241630 (SOS1)
   05225 Hepatocellular carcinoma
    113241630 (SOS1)
   05226 Gastric cancer
    113241630 (SOS1)
   05214 Glioma
    113241630 (SOS1)
   05221 Acute myeloid leukemia
    113241630 (SOS1)
   05220 Chronic myeloid leukemia
    113241630 (SOS1)
   05211 Renal cell carcinoma
    113241630 (SOS1)
   05215 Prostate cancer
    113241630 (SOS1)
   05213 Endometrial cancer
    113241630 (SOS1)
   05224 Breast cancer
    113241630 (SOS1)
   05223 Non-small cell lung cancer
    113241630 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    113241630 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    113241630 (SOS1)
   05160 Hepatitis C
    113241630 (SOS1)
   05163 Human cytomegalovirus infection
    113241630 (SOS1)
   05165 Human papillomavirus infection
    113241630 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113241630 (SOS1)
   01522 Endocrine resistance
    113241630 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 113241630
NCBI-ProteinID: XP_026335164
UniProt: A0A3Q7UUX7
LinkDB
Position
Unknown
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVSLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSLSDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLPSVTGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcacccaagtggcgg
gggctgctggtgccggcgctgaaaaaggtccaggggcaagttcatccgactcttgagtct
agtgatgatgctcttcagtatgttgaggaattaattttgcagttattaaatatgctatgc
caagctcagccccgaagcgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttactaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagac
atcttaaagctggtggggaattatgtacgaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattaatggacatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagagcaaact
tattatgatttggtaaaagcatttatggcagaaattcgacagtacataagggaactaaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaat
gatgtagaaaatatatttagccgtatagtagatatacacgaacttagtgtaaagttactg
ggccatatagaagatactgtggaaatgactgatgaaggtagcccccatcccttagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattttacggcctggttttcatgatcgtttccttagtcagttatcaaagcctggagcg
gcactctatttacagtcaataggcgaaggtttcaaagaagctgttcagtatgttttaccc
aggctacttctagcccctgtttaccactgtctacattactttgaacttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcaaaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacatgaaagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaaccatgggcagccaagactc
cctggtgctagcaacgcagagtatcgtcttaaagaaaagtttttcatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ctgatatctttacagtaccggagtacgctggagaggatgctcgatgtgacgatgctgcag
gaagagaaggaggagcagatgaggctccctagtgccgatgtttatagatttgcagagcct
gactctgaagagaatataatatttgaagaaaacatgcagcccaaggctggaatcccaatt
atcaaagcgggaactgttattaaacttatagagaggctcacataccatatgtatgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagccatagagaatggagatcagcccttgagtgcagaactaaaaaggtttagaaaagaa
tacatacagcctgtacagctgcgagtattaaatgtatgtcggcattgggtagagcaccac
ttctatgattttgaaagggatgcagatcttttgcagcgaatggaagaatttattggaaca
gtgagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcatataagcaggcctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
cttctaaaaatgatccggcataccactaacctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagattctacaa
gtctttcaagagctgaacaacttcaacggtgtccttgaggttgtcagtgctatgaactcc
tcacctgtttacagactagaccacacatttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaattaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccgtgcgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaaggcatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggagagatccagcaataccaaaatcagccttattgt
ttacgagtagaatcagatatcaaaaggttctttgaaaatttgaatccaatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgagacatcccacacctctgcagcaggagccc
aggaaaatcagttacagtaggatccccgaaagtgaaacagaaagtacagcgtctgcaccg
aattctccaagaacaccgttaacacctccgcctgcttccggcgcttctagtaccacggat
gtttgcagcgtttttgattccgatcattcgagcccttttcactcaagcagcgataccgtc
tttatccaagtttcactgccccatggcccaagatctgcttcagtatcatctataagtcta
accaagggcactgatgaagtgcctgtcccccctcctgtccctccacgaagacggccagaa
tccgcccccgccgagtcttcgccgtctaagattatgtctaagcatttggacagcccccca
gcaattcctcctaggcagcccacatcaaaagcctattcaccacgatattcaatatcagac
cggacctcgctatcagaccctcctgagagccctcccttattaccaccacgagaacctgtg
aggacacctgatgttttctccagctcaccactacatctgcagcctccccctttgggcaaa
aaaagtgatcatggcaatgccttcttcccgaacagcccttccccttttacaccgcctcct
cctcaaacaccctctcctcatggcacgagaaggcatctgccatcgccaccactgacacaa
gaagtggaccttccttccgtcactgggccgcctgttcctccacgacaaagcacttctcaa
catatccctaaactccctccaaaaacttacaaaagggagcacacacacccatccatgcac
agggatggcccaccgctgctggagaacgcccattcgtcctga

KEGG   Ursus arctos horribilis: 113266205
Entry
113266205         CDS       T05909                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2 isoform X1
  KO
K03099  son of sevenless
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01522  Endocrine resistance
uah04010  MAPK signaling pathway
uah04012  ErbB signaling pathway
uah04014  Ras signaling pathway
uah04062  Chemokine signaling pathway
uah04068  FoxO signaling pathway
uah04072  Phospholipase D signaling pathway
uah04150  mTOR signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04510  Focal adhesion
uah04540  Gap junction
uah04630  JAK-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04660  T cell receptor signaling pathway
uah04662  B cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04714  Thermogenesis
uah04722  Neurotrophin signaling pathway
uah04810  Regulation of actin cytoskeleton
uah04910  Insulin signaling pathway
uah04912  GnRH signaling pathway
uah04915  Estrogen signaling pathway
uah04917  Prolactin signaling pathway
uah04926  Relaxin signaling pathway
uah04935  Growth hormone synthesis, secretion and action
uah05034  Alcoholism
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05163  Human cytomegalovirus infection
uah05165  Human papillomavirus infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
uah05210  Colorectal cancer
uah05211  Renal cell carcinoma
uah05213  Endometrial cancer
uah05214  Glioma
uah05215  Prostate cancer
uah05220  Chronic myeloid leukemia
uah05221  Acute myeloid leukemia
uah05223  Non-small cell lung cancer
uah05224  Breast cancer
uah05225  Hepatocellular carcinoma
uah05226  Gastric cancer
uah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    113266205 (SOS2)
   04010 MAPK signaling pathway
    113266205 (SOS2)
   04012 ErbB signaling pathway
    113266205 (SOS2)
   04630 JAK-STAT signaling pathway
    113266205 (SOS2)
   04068 FoxO signaling pathway
    113266205 (SOS2)
   04072 Phospholipase D signaling pathway
    113266205 (SOS2)
   04151 PI3K-Akt signaling pathway
    113266205 (SOS2)
   04150 mTOR signaling pathway
    113266205 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113266205 (SOS2)
   04540 Gap junction
    113266205 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113266205 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113266205 (SOS2)
   04660 T cell receptor signaling pathway
    113266205 (SOS2)
   04662 B cell receptor signaling pathway
    113266205 (SOS2)
   04664 Fc epsilon RI signaling pathway
    113266205 (SOS2)
   04062 Chemokine signaling pathway
    113266205 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    113266205 (SOS2)
   04912 GnRH signaling pathway
    113266205 (SOS2)
   04915 Estrogen signaling pathway
    113266205 (SOS2)
   04917 Prolactin signaling pathway
    113266205 (SOS2)
   04926 Relaxin signaling pathway
    113266205 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    113266205 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113266205 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    113266205 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113266205 (SOS2)
   05206 MicroRNAs in cancer
    113266205 (SOS2)
   05205 Proteoglycans in cancer
    113266205 (SOS2)
   05231 Choline metabolism in cancer
    113266205 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113266205 (SOS2)
   05225 Hepatocellular carcinoma
    113266205 (SOS2)
   05226 Gastric cancer
    113266205 (SOS2)
   05214 Glioma
    113266205 (SOS2)
   05221 Acute myeloid leukemia
    113266205 (SOS2)
   05220 Chronic myeloid leukemia
    113266205 (SOS2)
   05211 Renal cell carcinoma
    113266205 (SOS2)
   05215 Prostate cancer
    113266205 (SOS2)
   05213 Endometrial cancer
    113266205 (SOS2)
   05224 Breast cancer
    113266205 (SOS2)
   05223 Non-small cell lung cancer
    113266205 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    113266205 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    113266205 (SOS2)
   05160 Hepatitis C
    113266205 (SOS2)
   05163 Human cytomegalovirus infection
    113266205 (SOS2)
   05165 Human papillomavirus infection
    113266205 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113266205 (SOS2)
   01522 Endocrine resistance
    113266205 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13 PH_9
Other DBs
NCBI-GeneID: 113266205
NCBI-ProteinID: XP_026369469
UniProt: A0A3Q7XRI6
LinkDB
Position
Unknown
AA seq 1332 aa
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPRSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
DRIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIFAAKSAEEKNNWMSALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPAIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPCKMSFSRIAETDIESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLSSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDDDASNCKGNTKSDDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPPSTPSPRVPRRCYVLSSSHNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPSY
RLPLLENAETPQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtacgagttcttcagcgaagaaaacagtccgaaatggcgg
ggactgctggtcccggccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctgtattatattgaagagctgatttttcagctgcttaataaattatgc
atggctcaaccaaggactgttcaagatgtggaggaacgtgttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacaatctgccatagaaaaacgaaaacgaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactatcatgtatccctatatattgtggctgtgctagagtatatctcagctgat
attttgaagttggctggtaattatgtttttaatatccgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctctgtgaagacgagcctcgttcttcaggtgaattaaactactat
gaccttgtcagaaccgaaattgcagaagaaaggcagtatctacgggaactaaatatgatc
attaaagtgtttcgagaagcctttctttctgacagaaagctgtttaaaccttctgatatt
gacaggattttcagtaacatttcagatatacatgaattaactgtgaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatccgttagcgggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatt
ctttctccaaaatttaatgaacatttcagtaagttgatggccagacctgcggtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgcctgtttatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcaggaagacagagaatgtttgaaccaagctattaccgctcttatgaat
ctccaaggtagtatggaccggatttacaagcagtattcacctagacgccgacctggcgat
cctgtttgccctttttataatcgtcaattaagaagcaagcatctggctattaaaaaaatg
aatgaaattcagaaaaacatagacggatgggaaggcaaagatattggacagtgttgtaat
gaattcattatggaaggcccattgacacgaattggtgctaaacatgaacgacatattttt
ctctttgatggcttaatgattagctgtaaacccaatcatagtcagtcacgccttccaggt
tatagtagtgcagaatacagattaaaagagaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacttgtgagtgcaaacatgcttttgagttggtatccaaagatgaaaac
agcataatatttgctgctaagtctgccgaagagaaaaacaattggatgtccgcgcttatt
tctcttcactatcgtagtacactagatcgaatgctagattcagtgttattgaaagaagaa
aatgagcaaccactgagattaccaagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacctgcaaagtagaagtggaatccccattattaaa
ggaggaactgtagtgaaattaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacataccgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggcc
gtagagaaaggcgaacagccaatcagtgcagaccttaaaaggtttcgcaaggaatatgtc
caaccagtacaacttaggatcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagggatttggaattgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaagtgggtagagtcaattgctaagatcatcaagagaaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccagcaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatctcatgacccttcatccaata
gaaattgcacgtcagctgacgcttttggaatctgatctctacaggaaagtccaaccttct
gaactagtagggagtgtatggacgaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccataccacaaacctcaccttatggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcaatactaagcagaattatagaaattctgcaagttttt
caagatttgaataacttcaatggtgtattggagatagtcagtgcagtaaattcagtgtcg
gtatacagactagaccatacttttgaggcattgcaggaaagaaaaaggagaattttggat
gaagctgtggagttaagtcaagatcactttaaaaaatacctagtaaaactgaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatatcctgaaaactgaagaa
gggaataatgattttttaaaaaagaaaggaaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcagtatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggaggttctttgaaaaccttaaccccatgggaagtgcttctgaa
aaggagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaatacggcct
aatgcaggccgacatggctctacctcaggcactttacgaggtcatccaacgccattagaa
agagaaccatgtaaaatgagctttagtcggattgctgaaactgatattgaatcaactgtg
tcagcaccaacctctccaaatacaccatctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggacctcagcagttcctgtggcagcaatagcatctttgctcca
gtcctcttgccacattcaaaatctttcttcagttcatgtggtagtttacataaactaagt
gaagagccactgattcctcctccacttcctcctcgaaaaaagtttgacgacgatgcttca
aactgcaagggaaacacgaaatctgatgatgacccccctgctattccaccaagacagcct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgcatttgatgggcctctg
cacagtccacctccaccgccaccaagagatcctcttcctgatacccctccaccagttccc
cttcggcctccagaacactttataaactgtccgtttaatcttcagccacctccactagga
catcttcacagagatccagactggttcagagatgttagtacctgtccaaactcgccaaat
actcctcctagcacaccctctccgagagtaccacgtcgatgctacgtgctcagttccagt
cacaacaaccttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
cacctaccaaaactgccaccaaagacttacaaacgggagctttcgcaccctccatcatac
agactgcctttgctagaaaatgcggaaactcctcagtga

DBGET integrated database retrieval system