KEGG   Ursus arctos horribilis: 113241866
Entry
113241866         CDS       T05909                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains protein 1 isoform X1
  KO
K14365  four and a half LIM domains protein 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113241866 (FHL1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase zf-C3HC4_3
Other DBs
NCBI-GeneID: 113241866
NCBI-ProteinID: XP_026335499
UniProt: A0A3Q7UXT5
LinkDB
Position
Unknown
AA seq 339 aa
MASHRHSGPSSYKVGTMTEKFDCHYCRDSLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVTYKNRYWHDTCFRCAKCLHPLANETFVSKDNKILCNKCTTREDSPKCKGC
FKPIVAGDQNVEYKKTVWHKDCFTCSHCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttcccataggcactcaggtccctccagctacaaggtgggcaccatgactgagaag
ttcgactgccactactgcagggactccctgcaggggaagaagtacgtgcagaaggatggc
caccactgctgcctgaagtgcttcgacaagttctgcgccaacacctgtgtggagtgccgg
aagcccattggggccgactccaaggaggtgacctacaagaaccgctactggcatgacacc
tgcttccgctgtgccaagtgccttcaccccttggccaacgagacctttgtgtccaaggac
aacaagattctgtgcaacaagtgcaccacccgggaggactcccccaagtgcaagggctgc
ttcaagccgatcgtggcaggagaccagaacgtggagtacaagaagaccgtctggcacaaa
gactgcttcacctgcagccactgcaagcaagtcatcgggactggaagcttcttcccgaaa
ggggaggacttctactgcgtgacttgccatgagaccaaatttgccaaacattgcgtgaag
tgcaacaaggccatcacctctggaggaatcacttaccaggatcagccctggcatgccgag
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcacggggaaaaggactgtgtcaagagtgagccacccagtctctaaagct
aggaagcccccagtgtgccacgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtggtggttctttat
agaaaaaatcgaagcttagcagctcctcgaggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtga

DBGET integrated database retrieval system