KEGG   Ursus arctos horribilis: 113242377
Entry
113242377         CDS       T05909                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
uah  Ursus arctos horribilis
Pathway
uah04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113242377 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:uah04030]
    113242377 (PTGDR)
G protein-coupled receptors [BR:uah04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    113242377 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 PhoR ResB
Other DBs
NCBI-GeneID: 113242377
NCBI-ProteinID: XP_026336171
UniProt: A0A3Q7TJA7
LinkDB
Position
Unknown
AA seq 463 aa
MFLSFRLWARGLVSPRTGASARRSLRGRCWLRKASLGCARGRAARPERRGVTQSLDRRRL
PCGTAPRPRSCLSSEVPRGAAGVPTRRRRGPGPLSARLLPAAPPTMRPPLYRCHNSTSVE
KGNSATMGGVLFSAGLLGNLLALGLLARSGLGSCPPRPPPSVFYVLVCCLTVTDLLGKSL
VSPFVLAAYAQNRSLWGLAPASGSSLCQAFAFFMSFFGLASTLQLLAMALECWLSLGHPF
FYRRHITLRRGALVAPVVGAFCLAFCALPFAGFGKFVQYCPGTWCFIQMVHEERSMSVLG
YSVLYASLMALLVLAIVLCNLSAMRNLYAMHRRLRRRPRSGTRDRVEPGADEKEAAAQPL
EELDHLLLLALMTVLFTLCSLPLIYRAYYGAFKTVHEKDGTSEEMEDLRALRFLSVISIV
DPWIFIIFRTPVFRMFFHKIFIRPLMYRNCPNNSCRTNMESSL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtttctttctttccgactctgggcacgagggcttgtctctcctcggaccggcgcgtca
gcgcggagatctttgcgcggccgctgctggctccgcaaagccagcttggggtgcgcacgc
ggccgcgcggcccgccccgagaggcggggtgtgacccagagtttagataggaggcgcctg
ccgtgcggaacagccccgcgcccgcggagctgcctctcgtccgaagtcccgcgcggagcc
gcgggggttcccacacgcagacgccggggccctggccctctctcagcccggctcctgccc
gctgcgccgcccaccatgcggccgccgctctaccgctgccacaacagcacttcggtggag
aagggcaactcggcgacgatgggcggggtgctcttcagcgcgggcctcctgggcaacctg
ctggccctggggctgctggcgcgctcggggctggggtcgtgcccgccgcgcccgccgcct
tcggtcttctacgtgctagtgtgctgcctgacggtcacagacttgctgggcaaatccctc
gtgagccccttcgtgctcgccgcctacgcgcaaaaccggagcctgtggggactggcgccc
gcgtcgggcagctcgctgtgccaagccttcgccttcttcatgtccttctttgggctcgcc
tcgacgctgcagctcctggccatggccctggagtgctggctgtccttggggcaccccttt
ttctaccgacggcacatcaccctgcgccgcggcgcgctcgtggctccggtcgtgggcgcc
ttctgcctggctttctgcgcgctgcccttcgcgggcttcgggaagttcgtgcagtactgt
cctggcacctggtgcttcatccagatggtgcacgaggagcgctcaatgtcggtgctgggc
tactccgtgctctacgccagcctcatggcgctgctggtcctcgccatcgtgctgtgcaac
ttgagcgccatgcgcaacctctacgcgatgcaccggcggctgcggcggcgcccgcgctcc
ggcactcgggaccgcgtggagccgggcgccgacgagaaggaggcggccgcgcagcccctg
gaggagctggaccacctgctgctgctggcgctcatgaccgtgctcttcactctgtgctcc
ctgcctttaatatatcgtgcttactatggagcatttaaaaccgtccatgagaaagatgga
acctctgaagaaatggaagacctccgagccttgcgttttctgtctgtaatttccattgtg
gacccttggattttcataattttcagaacaccagtatttcggatgttttttcacaagatt
ttcataaggcctcttatgtacagaaattgtcccaacaattcctgtcgaactaacatggag
tccagtctgtga

DBGET integrated database retrieval system