KEGG   Ursus arctos horribilis: 113242440
Entry
113242440         CDS       T05909                                 

Gene name
IL19
Definition
(RefSeq) interleukin-19
  KO
K05444  interleukin 19
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113242440 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113242440 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113242440 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113242440 (IL19)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113242440 (IL19)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 113242440
NCBI-ProteinID: XP_026336236
UniProt: A0A3Q7TJG4
LinkDB
Position
Unknown
AA seq 177 aa
MKTPCVSLWLVAAVFFLCSVRARGLRRCLISMDIHHIEEAFQEIKKTIQAKDPFQNVTIL
STSETLHRIKPLDVCCMTKNLLAFYVDKVFKDHQELNPQILRKISSIANSFLYMQKALRQ
CQEQRQCHCRDEATNATRIIHSNYDQLEARSAAIKSLGELDVFLAWIDRNHQGTSAA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaagactccgtgtgtttccctctggctcgtcgctgctgtgttcttcctgtgttcagtg
cgtgcccgaggtctgaggaggtgtctgatttccatggacatacaccatatagaagaggct
ttccaagaaatcaaaaaaaccatccaagctaaggaccccttccaaaatgtcaccatcctg
tccacgtcggagaccctgcatagaattaagcccttagatgtctgctgcatgacgaagaac
ctcctggcattttacgtggacaaggtattcaaggaccatcaggagctgaacccccaaatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaggctctgagacaa
tgtcaggagcagaggcagtgccactgcagggacgaagccaccaatgccaccagaatcatc
cacagcaactatgatcagctggaggcccggtctgctgccattaagtctctgggagagctg
gacgtctttctagcctggattgacaggaatcatcaaggaacttctgcggcctga

KEGG   Ursus arctos horribilis: 113242441
Entry
113242441         CDS       T05909                                 

Gene name
IL20
Definition
(RefSeq) interleukin-20
  KO
K22667  interleukin 20
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113242441 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113242441 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113242441 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113242441 (IL20)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113242441 (IL20)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 113242441
NCBI-ProteinID: XP_026336237
UniProt: A0A3Q7VED4
LinkDB
Position
Unknown
AA seq 176 aa
MKASGLPICLFSAAFYLFWTPSAGLKTLRLGSCVITTNLQEMRNGFSEIRDSVQAKDEII
DIRILRKTESLQDTKPADQCCLLRHVLRLYLDRVFKNYQTPDHHILRKTSSLANSFLTIK
KDLRLCHAHMTCPCGEEAMEKYSQILSHFEELTPQAAVVKALGELDILLQWMEEMK
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaaagcctctggtcttcccatctgccttttctctgctgcattttatctcttctggaca
ccttctgctggactgaagacactccgtttgggaagctgcgtgatcaccacaaaccttcag
gaaatgcgaaatggattttctgagatacgagacagtgtgcaagccaaagatgaaatcatt
gatatcagaatcttgaggaagactgagtctttgcaagacacaaagcctgcagatcagtgc
tgcctcctccgccatgtactgagactctacctggacagggtattcaaaaactatcagact
cctgaccaccatatcctccggaagaccagcagtcttgccaactcttttcttaccatcaag
aaggacctccggctctgtcatgcgcatatgacatgcccttgtggagaggaagcaatggag
aaatacagccagattctgagtcacttcgaagagcttacgccgcaggcagcagtggtgaag
gctctgggagagctggacatcctcctgcaatggatggaggagatgaaatag

KEGG   Ursus arctos horribilis: 113242596
Entry
113242596         CDS       T05909                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04068  FoxO signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04660  T cell receptor signaling pathway
uah04672  Intestinal immune network for IgA production
uah05133  Pertussis
uah05135  Yersinia infection
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05150  Staphylococcus aureus infection
uah05152  Tuberculosis
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113242596 (IL10)
   04068 FoxO signaling pathway
    113242596 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113242596 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113242596 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113242596 (IL10)
   04660 T cell receptor signaling pathway
    113242596 (IL10)
   04672 Intestinal immune network for IgA production
    113242596 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113242596 (IL10)
   05322 Systemic lupus erythematosus
    113242596 (IL10)
   05320 Autoimmune thyroid disease
    113242596 (IL10)
   05321 Inflammatory bowel disease (IBD)
    113242596 (IL10)
   05330 Allograft rejection
    113242596 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113242596 (IL10)
   05133 Pertussis
    113242596 (IL10)
   05150 Staphylococcus aureus infection
    113242596 (IL10)
   05152 Tuberculosis
    113242596 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113242596 (IL10)
   05144 Malaria
    113242596 (IL10)
   05145 Toxoplasmosis
    113242596 (IL10)
   05140 Leishmaniasis
    113242596 (IL10)
   05142 Chagas disease (American trypanosomiasis)
    113242596 (IL10)
   05143 African trypanosomiasis
    113242596 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113242596 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113242596 (IL10)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113242596 (IL10)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113242596 (IL10)
SSDB
Motif
Pfam: IL10 IL22 ALIX_LYPXL_bnd CLZ
Other DBs
NCBI-GeneID: 113242596
NCBI-ProteinID: XP_026336515
UniProt: A0A3Q7U8C0
LinkDB
Position
Unknown
AA seq 178 aa
MPSPAQLCCLVLLAGVGASRHHTAPSEDNCTHFPASLPHMLRELRAAFGRVKTFFQMKDK
LDNILLTGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKAVEQVKSAFSKLQERGVYKAMSEFDIFINYIETYMTMRMKI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagcccagcgcagctgtgttgcctggtcctgctggccggggtaggagccagccga
caccacactgccccgtctgaggacaactgcacccacttcccagccagcctgccccacatg
ctgcgagagctccgagctgccttcggcagggtgaagactttctttcaaatgaaggacaag
ctggacaacatattgttgacggggtccttgctggaggactttaagggttacctgggttgc
caagccttgtcggagatgatccagttttacttggaggaggtgatgccccaggctgagaac
cacgacccagacatcaaggagcacgtgaactccctgggggaaaagctgaagaccctgcgg
ctgaggctgcggcgctgtcatcgatttctgccctgcgagaataagagcaaggcggtggag
caggtgaagagcgcctttagtaagctccaagagagaggtgtctacaaagccatgagtgaa
tttgacatcttcatcaactacatagaaacctacatgacaatgaggatgaaaatctga

KEGG   Ursus arctos horribilis: 113242598
Entry
113242598         CDS       T05909                                 

Gene name
IL24
Definition
(RefSeq) interleukin-24
  KO
K22668  interleukin 24
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113242598 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113242598 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113242598 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113242598 (IL24)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113242598 (IL24)
SSDB
Motif
Pfam: IL10 IL22 DUF4449 RICTOR_M
Other DBs
NCBI-GeneID: 113242598
NCBI-ProteinID: XP_026336518
UniProt: A0A3Q7UK34
LinkDB
Position
Unknown
AA seq 183 aa
MGFSRQTTALLCLNLILLLWSQAPGVQGQEFQFGPCRVEGVVLQELWEAFSAMKDIVQAK
DNITSVRLLRKEVLQNVSDAESCYLIRALLKFYLTTVFKNYLDKAADSRIRKSFSTLANN
FFVIVSKLQPSQENEMFSISESARRRFLLFQRAFKQLDIQAAQTKAFGEVDILLTWMEKF
YQF
NT seq 552 nt   +upstreamnt  +downstreamnt
atgggcttttcacggcagacaactgccctcctctgcctgaatctgatcctgcttctctgg
agccaggcgccaggggtccagggccaagagttccagttcggaccctgccgagtggaggga
gtagttctccaggaactgtgggaggccttctcggccatgaaggacattgtgcaagccaag
gataacatcacgagtgtccggctgctacggaaggaggttctgcagaacgtctcggatgcc
gagagctgttacctcatccgtgccctgctgaagttctacttgactaccgttttcaaaaac
tatctggataaggcagctgactccaggatccggaagtcattctctactctggccaacaac
ttttttgtcatcgtgtcaaaactacaacccagtcaggaaaatgagatgttttctatcagt
gagagtgcacgcaggcggtttctgctgttccagagagcatttaaacagttggacatacaa
gcagcccagaccaaagcctttggagaagtggacattctcttgacctggatggagaaattc
taccagttctga

KEGG   Ursus arctos horribilis: 113243223
Entry
113243223         CDS       T05909                                 

Definition
(RefSeq) interferon lambda-1-like
  KO
K05447  interferon lambda 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113243223
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113243223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243223
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113243223
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 113243223
NCBI-ProteinID: XP_026337514
UniProt: A0A3Q7V3T1
LinkDB
Position
Unknown
AA seq 189 aa
MAMAWVLVLVIAGLSLARAAPVPTSKPTTTWKGCDIGRFKSLSPRELEAFRKAKDALENS
LKNWSCSSRLFPRNRDLRQLQVWERPVALEAELILTLKVLETMADRSQGGILDQPLHTLR
HIHSELQACVETQPTAGPQPQGRLHHWLHRLSEASKKESQGCLEASVLFNLFRLLKKDLE
CVASGDLCV
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccatggcgtgggtcctggtgctggtgattgcggggctgagcttggccagagctgcc
cctgtccccacttccaagcccaccacaacctggaagggctgtgacattggcaggttcaaa
tctctgtcaccaagggagctggaggccttcaggaaggccaaagatgctttggaaaattca
ctaaaaaactggagttgcagctcccgcctcttccctagaaaccgagacctgagacagctg
caggtgtgggaacgccccgtggccttggaggctgagctgatcttgacgctgaaggtcctg
gagaccatggctgacaggtcccaggggggcatcctggaccagccccttcacacactgcgc
cacatccactctgagctccaggcctgtgttgagactcagcccacagcaggtccccagccc
caaggccgcctccaccactggctgcaccggctctcagaggcctcaaagaaagagtctcaa
ggctgcctcgaggcctctgtcctcttcaacctcttccgcctccttaaaaaggacttggaa
tgtgtcgccagtggagacctgtgtgtctga

KEGG   Ursus arctos horribilis: 113243255
Entry
113243255         CDS       T05909                                 

Definition
(RefSeq) interferon lambda-3-like
  KO
K22669  interferon lambda 2/3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113243255
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113243255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243255
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113243255
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 113243255
NCBI-ProteinID: XP_026337546
UniProt: A0A3Q7TMR4
LinkDB
Position
Unknown
AA seq 199 aa
MTESDQYTDTAVGCMLVTMVLTGAGAVPGPKPLGVLPDARGCHLAQFQSLSPQELQAFKK
AKDIFEESLSLKAWNCRPRLFPRTWDLQQLQVWERPMALEAEVALTLKVLETMADSSLGD
ILDQPLHTLRHIHSELQACVEAQPPTGPRPRGRLQHWLHRLHEAPKKESLGCLEASVMFN
LFRLLTRDLKCVASGDLCV
NT seq 600 nt   +upstreamnt  +downstreamnt
atgacagaaagtgaccagtatactgatacagctgtgggctgcatgctggtgactatggtg
ctgaccggggcaggagcagttcctggccccaagcccctcggggtcctcccagatgcaagg
ggctgccacttggcccagttccagtctctgtccccacaagagctgcaggccttcaagaag
gccaaggacatctttgaagagtcgctctccctgaaggcctggaactgccgcccccgcctc
ttccccaggacctgggacctgcagcagctgcaggtgtgggagcgccccatggccttggag
gccgaggtggccttgaccctgaaggtcctggagaccatggctgattcgtccctgggggac
atcctggaccagccccttcacacgctgcgccacatccactccgagctccaggcctgtgtc
gaggctcagcccccaacaggcccccggccccgaggccgcctccagcactggctgcaccgg
ctgcacgaggctccaaagaaggagtccctcggctgcctggaagcctctgtcatgttcaac
ctcttccgtctcctcacccgggacctgaagtgtgtggccagtggagacctgtgcgtgtga

KEGG   Ursus arctos horribilis: 113243256
Entry
113243256         CDS       T05909                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon lambda-3-like
  KO
K22669  interferon lambda 2/3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113243256
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113243256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113243256
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113243256
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 113243256
NCBI-ProteinID: XP_026337547
UniProt: A0A3Q7VHZ8
LinkDB
Position
Unknown
AA seq 175 aa
MDPRTAAISSSWRKRLRSQECSLVRGLKKEKDTFEESLSLKAWSCRPRLLPRTWDLQQLQ
LWEHPVALEAELALTLKVLETMAARHPLRAQSTQAMFALLHIPHSSARGSTWPXGHLRHW
LHXLQEASKKESLGCLEASVMFNLFHLLTWDLHQDPRCQCRPTYLIPETLLQQVP
NT seq 528 nt   +upstreamnt  +downstreamnt
atggatcccaggacggctgccatatcttcctcttggcgaaagaggcttaggagccaggaa
tgcagcctggtgaggggccttaagaaggagaaggacacctttgaagaatcgctctccctg
aaggcctggagctgccgcccccgcctcttgcccaggacctgggacctgcagcagctgcag
ttgtgggagcaccccgtggccttggaggctgagctggccttgaccctgaaggtcctggag
accatggctgcacgacacccactccgagctcagagcacccaggccatgtttgctctgctt
cacataccacactcctcagcccgcggcagcacctggccctgaggtcacctccggcactgg
ttgcactgactccaggaggcctcaaagaaggagtccctcggctgcctggaagcctctgtc
atgttcaacctcttccaccttctcacctgggaccttcaccaggacccgcgttgccagtgt
agacccacgtatctgatccctgagaccctcctgcagcaggtcccttag

KEGG   Ursus arctos horribilis: 113245026
Entry
113245026         CDS       T05909                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04550  Signaling pathways regulating pluripotency of stem cells
uah04630  Jak-STAT signaling pathway
uah04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113245026 (LIF)
   04668 TNF signaling pathway
    113245026 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113245026 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113245026 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113245026 (LIF)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113245026 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 113245026
NCBI-ProteinID: XP_026340582
UniProt: A0A3Q7VRG5
LinkDB
Position
Unknown
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCATRHPCHSNLMNQIRNQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTERTRLMDLYRIIAYLGASLGNIT
RDQKVLNPNALSLHSKLNATADIMRGLLSNVLCRLCNKYHVAHVDVAYGPDTSGKDVFQK
KKLGCQLLGKYKQVIAVVAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgctggttctgcactggaaacacggg
gcggggagcccccttcctatcacccctgtcaacgccacctgcgccacacgccacccatgt
cacagcaacctcatgaaccagatcaggaaccaactggcgcagctcaatggcagtgccaat
gctctctttattctctattacacagcccagggggagccgttccccaacaacctggacaag
ctgtgcggccccaacgtgacggacttcccgccgttccacgccaacggcacggagaggacg
cggctcatggatctctaccgcatcatcgcgtaccttggcgcctccctgggcaacatcacc
cgcgaccagaaggtcctcaatcccaacgccctcagcctccacagcaagctgaacgccact
gcggacatcatgcggggcctcctcagcaacgtgctctgccgcctgtgtaacaagtaccac
gtggcccacgtggacgtggcctacggccccgacacctcgggcaaggacgtcttccagaag
aagaagttgggctgtcagctcctggggaagtataagcaggtcatcgccgtggtggcgcag
gccttctag

KEGG   Ursus arctos horribilis: 113245027
Entry
113245027         CDS       T05909                                 

Gene name
OSM
Definition
(RefSeq) oncostatin-M isoform X1
  KO
K05418  oncostatin M
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113245027 (OSM)
   04151 PI3K-Akt signaling pathway
    113245027 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113245027 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113245027 (OSM)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113245027 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 113245027
NCBI-ProteinID: XP_026340583
UniProt: A0A3Q7VC93
LinkDB
Position
Unknown
AA seq 238 aa
MQAQLLRRTLPSLVLGLLFLSTPAMGVCLDKYQELFGQLQKQTDIMQRTSLLLDPYIKSQ
GLDKDGLKEHCRERPGAFPSKDALQRLSRREFLRALHTTLGSVLHRLTALQRDVPKAQDL
EMLNRAKQNIRGFRNNIHCMAQLLPDSSETTEPTPAGPATSPSPTPTSDTFQRRLEGCRF
LHGYHRFMHSVGQVFQEWGESPSRSRRHSPRRGLRKGVRRVQLSRRNKRLPPRGQLPR
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcaggcacagcttttgcggaggaccctgcccagtctggtccttggactcctgttcctg
agcacgccggccatgggcgtctgtttggacaagtaccaagagctgtttgggcagctccag
aagcagacggacatcatgcagcgcaccagcctgctcctggacccctatatcaaaagccaa
ggcctggacaaggatggactgaaggagcactgccgggagcgcccgggggccttccccagc
aaagacgccctgcagcggctgagcaggagggaattcctgcgggccctccacaccacgctg
ggcagcgttctgcacagactgactgccctgcagcgggacgtccccaaggcccaggacttg
gagatgctgaatagggcaaagcagaacattcgcgggttcaggaacaacatccactgcatg
gcccagctgcttccagactcctcggagacaacggagcccactcccgcaggcccggcgaca
tctccgtcgcccacccccacctcagacacctttcagcgcaggctagagggctgcaggttc
ctgcacggctatcaccgcttcatgcactccgtggggcaggtgttccaagagtggggggag
agcccgagtcggagccggagacacagcccccgccggggcctgcgaaagggggttcgcagg
gtgcaactgtccaggaggaacaagagactcccacccagggggcagctgccccggtag

KEGG   Ursus arctos horribilis: 113247369
Entry
113247369         CDS       T05909                                 

Gene name
IL11
Definition
(RefSeq) interleukin-11
  KO
K05417  interleukin 11
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113247369 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113247369 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113247369 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    113247369 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113247369 (IL11)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113247369 (IL11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 113247369
NCBI-ProteinID: XP_026344159
UniProt: A0A3Q7VMW8
LinkDB
Position
Unknown
AA seq 258 aa
MRERGGPGGADWLAGAGVGGAAGGWAAGEPEGRSPRAVRRRRVALRLPRPRYARASASLR
PGVCCLVLVALSLWPDRAAAPGPPPGPPRASPDPRAELDSAVLLTRSLLADTRQLAAQLR
DKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLFSYLRHVQWLRRAGGPSLRT
LEPELGALQARLDRLLRRLQLLMSRLALPQAPPDPPSPPLAPPASAWGGIRAAHAILGGL
HLTLDWAVRGLLLLKTRL
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcgggagcggggcggcccggggggcgctgattggctggcgggcgcgggggtgggcggg
gcagctgggggatgggctgccggggagccagagggccggagcccccgagctgtgcgccgc
cgccgggtcgctctccgcctcccgcggccccgctacgcccgcgcctctgcctctctccgc
ccaggtgtttgctgcctggtcctggtcgccctgagcctgtggccagatagagctgctgcc
ccagggccacctcctggccccccgcgggcctctccagaccctcgggctgagctggacagc
gccgtcctcctgacccgctccctcctggccgacactcggcagcttgcggcacagctgaga
gacaagtttccagccgacggagaccacaacctggactctcttcctaccttggccatgagt
gcaggggcgctgggagccctacaactcccaggtgtgctgacacggctgcgagccgacctg
ttctcctacctgcgccatgtacagtggctgcgccgagcggggggcccttccctgcggacc
ctggagccggagctgggtgccctgcaggcccggctggaccgcctgctgcgccggctgcag
ctcctgatgtcccgcctggccttaccccaagcacccccagacccaccatctcccccgctg
gcccccccggcctctgcctggggaggcatcagggcagcccatgccattcttggggggctg
cacctgacccttgactgggccgtgcggggcttgctgctgctgaagactcggctgtga

KEGG   Ursus arctos horribilis: 113251173
Entry
113251173         CDS       T05909                                 

Gene name
IL17D
Definition
(RefSeq) interleukin-17D
  KO
K05492  interleukin 17D
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04657  IL-17 signaling pathway
uah04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113251173 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113251173 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113251173 (IL17D)
   04659 Th17 cell differentiation
    113251173 (IL17D)
   04657 IL-17 signaling pathway
    113251173 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113251173 (IL17D)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113251173 (IL17D)
SSDB
Motif
Pfam: IL17 Phage_holin_7_1
Other DBs
NCBI-GeneID: 113251173
NCBI-ProteinID: XP_026348757
UniProt: A0A3Q7WEI8
LinkDB
Position
Unknown
AA seq 209 aa
MARAGVWMLVVGVLLALAPGRAAGALRASRRPARPRGCADRPEELLEQLYGRLAAGVLGA
FHHTLQLGPREQARNASCPAGGRPGDRRFRPPTNLRSVSPWAYRISYDPARYPKYLPEAY
CLCRGCLTGLFGEEDLRFRSAPVYMPTVILRRTSACAGGRSVYVEEYVTVPVGCTCVPEP
EKEADSPNSSMDKPGAKLLLSPGDKPGRP
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgcgtgcgggggtctggatgctggtggtcggcgtcctgctggcgttggcgccgggc
cgggccgcaggcgccctgagggcgagcagacgcccggcgcggccgcggggctgcgccgac
cggcccgaggagctcctggagcagctgtacgggcggctggcggcgggcgtgctcggcgcc
ttccaccacacgctgcagctggggccgcgcgagcaggcgcgtaacgcgagctgcccggca
gggggcaggcccggcgaccggcgcttccggccgcccaccaacctgcgcagcgtgtcgccg
tgggcctacagaatttcctacgaccccgccaggtacccgaagtacctgcccgaggcctac
tgcctgtgcagaggctgcctgaccgggctgttcggggaggaggatctgcgtttccggagc
gccccggtgtacatgcccaccgtcatcctgcggcggacgtcggcctgcgcgggcggccgc
tcggtgtacgtggaggagtacgtcaccgtgccggtgggctgcacctgcgtccccgagccc
gagaaggaggcggacagccccaactccagcatggacaagccgggcgccaagctcctgctc
agccccggcgacaagccgggccggccctga

KEGG   Ursus arctos horribilis: 113253022
Entry
113253022         CDS       T05909                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7
  KO
K05431  interleukin 7
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113253022 (IL7)
   04151 PI3K-Akt signaling pathway
    113253022 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113253022 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113253022 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113253022 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113253022 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113253022 (IL7)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113253022 (IL7)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113253022 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 113253022
NCBI-ProteinID: XP_026351633
UniProt: A0A3Q7VRL5
LinkDB
Position
Unknown
AA seq 158 aa
MFHVSFRYIFGIPPLILVLLPVASSDCDIEGKDGREYQHVLMISINDLDTMIKNRTNCPN
NEPKVLKKHACDDNKEGMFLYRAARKLKQFVKVNNSEDFNLHLSRVSQGTLQLLNCTPKE
DNKSVKEQRKQKSLCSLGILLQKIKTCWNKILRGSKEH
NT seq 477 nt   +upstreamnt  +downstreamnt
atgttccatgtttctttcaggtatatctttggaattcctcccctgatccttgttctgttg
ccggtagcatcatccgactgtgatattgaaggtaaagacggcagagagtaccaacacgtt
ctcatgatcagcatcaatgacttggacaccatgataaaaaatcgtaccaattgcccgaat
aatgaacctaaagtattaaaaaaacatgcatgtgatgataataaggaaggtatgtttcta
tatcgtgctgctcgcaagttgaagcagtttgttaaagtgaataacagtgaggatttcaat
ctccacttatcaagagtctcacagggcacattacaattgttgaactgtacccccaaggaa
gacaataaatctgtaaaggaacagagaaaacagaagagcttgtgttccctagggatacta
ctacaaaagataaaaacttgttggaataaaattttgaggggctctaaagaacattga

KEGG   Ursus arctos horribilis: 113254130
Entry
113254130         CDS       T05909                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04620  Toll-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04940  Type I diabetes mellitus
uah05133  Pertussis
uah05134  Legionellosis
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05162  Measles
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254130 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113254130 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113254130 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    113254130 (IL12A)
   04625 C-type lectin receptor signaling pathway
    113254130 (IL12A)
   04658 Th1 and Th2 cell differentiation
    113254130 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113254130 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113254130 (IL12A)
   05330 Allograft rejection
    113254130 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113254130 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    113254130 (IL12A)
   05134 Legionellosis
    113254130 (IL12A)
   05152 Tuberculosis
    113254130 (IL12A)
  09172 Infectious disease: viral
   05162 Measles
    113254130 (IL12A)
   05164 Influenza A
    113254130 (IL12A)
   05168 Herpes simplex virus 1 infection
    113254130 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113254130 (IL12A)
   05144 Malaria
    113254130 (IL12A)
   05145 Toxoplasmosis
    113254130 (IL12A)
   05140 Leishmaniasis
    113254130 (IL12A)
   05142 Chagas disease (American trypanosomiasis)
    113254130 (IL12A)
   05143 African trypanosomiasis
    113254130 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113254130 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113254130 (IL12A)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113254130 (IL12A)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113254130 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 113254130
NCBI-ProteinID: XP_026353170
UniProt: A0A3Q7VLU3
LinkDB
Position
Unknown
AA seq 222 aa
MCPPRGLLLATVLVLLNHLDHLGLARSLPPASPSPGMFPCLNHSQNLLRAVSNSLQKARQ
TLELYSCTSEEIDHEDMTKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKAS
FMTTLCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIFLDQNMLTAIDELLQALNFNSVTV
PQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtgcccgccgcgcggcctcctcctcgcgaccgtcctggtcctcctaaaccacctggac
cacctcggtttggccaggagcctccccccagcgtccccaagcccagggatgttcccgtgc
ctcaaccactcccaaaacctgctgagagccgtcagcaactcgcttcagaaggccagacaa
actctagaactttactcctgcacttctgaagagattgatcatgaagacatgacaaaggat
aaaaccagcacagtggaggcctgcttaccgttggaattaaccatgaatgagagttgcctg
gcttccagagagatctctttgataactaatgggagttgcctggcatccagaaaggcctct
tttatgacaaccctgtgccttagcagtatctatgaggacttgaagatgtaccaggtggag
ttcaaggccatgaacgcaaagctcctaatggatcctaagaggcagatctttctggatcaa
aacatgctgacagctattgatgagctgttacaggccctgaatttcaacagtgtgactgtg
ccacagaaatcctcccttgaagaaccggatttttataaaactaaaatcaagctctgcata
cttcttcacgctttcagaattcgggcggtgaccatcgatagaatgatgagctatctgaat
tcttcctaa

KEGG   Ursus arctos horribilis: 113254959
Entry
113254959         CDS       T05909                                 

Gene name
TSLP
Definition
(RefSeq) thymic stromal lymphopoietin
  KO
K05436  thymic stromal lymphopoietin
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113254959 (TSLP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113254959 (TSLP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113254959 (TSLP)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113254959 (TSLP)
SSDB
Motif
Pfam: TSLP
Other DBs
NCBI-GeneID: 113254959
NCBI-ProteinID: XP_026354221
UniProt: A0A3Q7UZ12
LinkDB
Position
Unknown
AA seq 245 aa
MNEGLQVQIRARHLVVAPVPTTRAVLRPEATEAVTAAQRGTKRLGRTGARTRAPPEEPRA
GQHPPCARKAARHAARWGPAACLARSPFAGLEGGAVKFVLSVFFRKIFILQLVGLVLTYN
FTDCDFEKIRKKYQEVIYQALEKYMNGTKSTEFNNPIYCEDPPDCLTKIERITFYPTHGC
TSLAEEIFAIGTNATLTLQCPGYSGMQINNTQAKKKRKKREVTTNKCRERVAYLIGLWRR
FSRIS
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaacgagggtttgcaagtacaaatccgcgcccgccacctcgttgtcgctcctgtccct
acaacccgcgcggtgctcaggcctgaggcgaccgaagctgtcacggctgcgcagcgcggg
actaagcgcctgggacgcacgggcgcacgaacccgcgcgcctccggaagagccgcgcgct
ggacagcaccctccctgcgcgcgcaaggctgcgcgccacgcggcgcggtggggccccgct
gcttgtctggcgcgctcgcccttcgccggccttgagggtggggctgtgaagtttgttctg
tcagtttttttcaggaaaatcttcatcttgcaactggtagggctggtgctaacctacaat
tttactgactgtgactttgagaagattagaaagaagtatcaggaagtcatttatcaagcc
ctggagaaatacatgaatgggaccaaaagcaccgaattcaacaaccccatctactgtgaa
gacccgccagattgcctcactaaaatcgaacgcattaccttctatcccacccacggctgc
acgtctctcgccgaggaaatctttgcaataggaactaatgctacgctcactctccagtgc
ccaggctactccggaatgcagataaataatacccaggcaaagaagaaaagaaagaaaaga
gaagtcacaacaaataaatgccgggaacgagttgcatacttaataggactgtggcgtcgt
ttcagtcgcatttcatag

KEGG   Ursus arctos horribilis: 113255465
Entry
113255465         CDS       T05909                                 

Gene name
IL21
Definition
(RefSeq) interleukin-21
  KO
K05434  interleukin 21
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113255465 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113255465 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113255465 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113255465 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255465 (IL21)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113255465 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 113255465
NCBI-ProteinID: XP_026354870
UniProt: A0A3Q7VRL2
LinkDB
Position
Unknown
AA seq 153 aa
MRYSAGNMEKIVICLTVIFLGTVAHKSSFQEQDRYLIRMRQLINIVDQLKNYVNDLDPES
LPAPEDVKRHCEQSAFSCFQKAQIKAANTGGNEQLISVLTKQLKRKLPPTNAGRRQKHRP
TCPSCDSYEKTPPKEFLERLKSLIQRMIHQHLS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgagatacagtgctggcaacatggagaagatagtcatctgcctgacggtcatcttcttg
gggacagtggctcataagtcaagcttccaagagcaagatcgctacttgattagaatgcgt
caacttataaatattgttgatcagctgaaaaattatgtgaatgacttggaccctgaatct
ctgccagctccagaagatgtaaagagacattgtgagcagtcagctttttcatgttttcag
aaggcccaaataaaggcagcaaatacaggaggcaatgaacaactaatcagtgtattaact
aaacagctgaagaggaaactacctcccacaaatgcaggcagaagacagaaacacagacca
acatgcccctcatgtgattcttatgagaaaacaccacccaaagaattcctagaaagactg
aaatcactcatccaaaggatgattcatcagcatctctcctag

KEGG   Ursus arctos horribilis: 113255635
Entry
113255635         CDS       T05909                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04151  PI3K-Akt signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04672  Intestinal immune network for IgA production
uah04940  Type I diabetes mellitus
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05162  Measles
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113255635 (IL2)
   04151 PI3K-Akt signaling pathway
    113255635 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113255635 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113255635 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113255635 (IL2)
   04660 T cell receptor signaling pathway
    113255635 (IL2)
   04658 Th1 and Th2 cell differentiation
    113255635 (IL2)
   04659 Th17 cell differentiation
    113255635 (IL2)
   04672 Intestinal immune network for IgA production
    113255635 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255635 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113255635 (IL2)
   05321 Inflammatory bowel disease (IBD)
    113255635 (IL2)
   05330 Allograft rejection
    113255635 (IL2)
   05332 Graft-versus-host disease
    113255635 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113255635 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113255635 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113255635 (IL2)
   05162 Measles
    113255635 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113255635 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255635 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113255635 (IL2)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113255635 (IL2)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113255635 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 113255635
NCBI-ProteinID: XP_026355067
UniProt: A0A3Q7WXD6
LinkDB
Position
Unknown
AA seq 155 aa
MYKMQLLYCIALTLVLVANSAPTTSSPTKETQQQLEQLLLDLRLLLNGVNNYENPKLSRM
LTFKFYMPKKATELKHLQCLAEELKLLEEVLYLDQSKNLHLTDIKELMSNINVTLLKLKG
SEASFKCEYDDETVTITEFLNKWITFCQSIFSTLT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtattgcatcgcactgactcttgtactcgtcgcaaacagt
gcacctactacttcaagccctacgaaggaaacacagcaacagctggagcaattgctgctg
gatttacggttgctcttgaatggagttaataattatgagaaccccaaactctccaggatg
ctcacgtttaaattctacatgcccaagaaggccacagaattgaaacatcttcaatgtcta
gcagaagaactcaaacttctggaggaagtgctatatttagatcaaagcaaaaaccttcac
ttgacagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaaggga
tcagaagcaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg
aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

KEGG   Ursus arctos horribilis: 113255706
Entry
113255706         CDS       T05909                                 

Gene name
IL15
Definition
(RefSeq) interleukin-15 isoform X1
  KO
K05433  interleukin 15
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04668  TNF signaling pathway
uah04672  Intestinal immune network for IgA production
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113255706 (IL15)
   04668 TNF signaling pathway
    113255706 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113255706 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    113255706 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113255706 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113255706 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113255706 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255706 (IL15)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113255706 (IL15)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 113255706
NCBI-ProteinID: XP_026355177
UniProt: A0A3Q7WLZ3
LinkDB
Position
Unknown
AA seq 161 aa
MRISKPYLRSTSIQCYLCLLLNSHFLTEAGIHVFILGCISAGLPKTEANWQFVIRDLEKI
DNIIQSIHIDTTLYTESDAHPSCKVTAMKCFLLELRVISLEFKHDVLNETVENLIFLAND
RLSANGNITETGCKECEELEEKNIKEFLQSFVHIVQMFINS
NT seq 486 nt   +upstreamnt  +downstreamnt
atgagaatttcgaaaccatatctgagaagtacttccatccagtgctacttgtgtttgctt
ttgaacagtcattttctaaccgaggccggcattcatgtcttcattttgggctgtatcagt
gcaggtcttcctaaaacagaggcaaactggcagtttgtaatacgtgatttggaaaaaatt
gacaatattattcaatctatacatattgataccactttatatactgaaagtgatgctcat
cccagttgcaaagtaacagcgatgaagtgctttctcctggagttacgtgttatctcgctg
gagttcaaacatgatgtccttaatgaaacggtggagaaccttatcttcctagcaaatgat
cgtttgtctgctaatgggaacataactgaaacgggatgcaaagaatgtgaggaattggag
gaaaaaaatattaaagaatttttgcagagttttgtccatattgtacaaatgttcatcaac
tcttga

KEGG   Ursus arctos horribilis: 113255914
Entry
113255914         CDS       T05909                                 

Gene name
IL22
Definition
(RefSeq) interleukin-22
  KO
K05445  interleukin 22
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113255914 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113255914 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    113255914 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113255914 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113255914 (IL22)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113255914 (IL22)
SSDB
Motif
Pfam: IL22 IL10 IL28A
Other DBs
NCBI-GeneID: 113255914
NCBI-ProteinID: XP_026355412
UniProt: A0A3Q7WYF1
LinkDB
Position
Unknown
AA seq 179 aa
MVALQKSGSPSLMGIPAASCLLLITLWVQGGAAVPLGSPCRLNSSDFQQPYITNRTFMLA
EEASLADNNTDVRLIGDQLFHGVNMGDRCYLMKEVLNFTLEEVLLPQSHRFQPYMQEVVP
FLAKLSNRLSQCHIERDDQHIQRNVQNLKDTVTKLGENGEIKAIGELNLLFIALKNACI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggtcgccctacagaagtctgggagcccttcccttatgggaattccggccgccagctgc
ctccttctcattaccttgtgggtgcagggaggagcagccgtgcccctcggctctccctgc
aggctcaacagctccgacttccagcagccctacatcaccaaccgtaccttcatgctggct
gaggaggctagtttggcagataacaacacagatgttcgtctcattggggatcaactgttc
cacggagtcaatatgggagaccgctgctatctgatgaaggaggtgctgaactttaccctt
gaagaagtgctgcttccccagtcccatagattccagccttatatgcaggaggtggtgccc
ttcctggccaagctcagcaacaggctaagccaatgtcatatcgagcgcgatgaccagcat
atccagagaaatgtgcagaacctgaaggacacagtgacaaagcttggagagaacggagag
atcaaagcaatcggagaactgaatttgctgtttatagccctgaaaaatgcctgcatttga

KEGG   Ursus arctos horribilis: 113256304
Entry
113256304         CDS       T05909                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
uah  Ursus arctos horribilis
Pathway
uah03050  Proteasome
uah04060  Cytokine-cytokine receptor interaction
uah04066  HIF-1 signaling pathway
uah04217  Necroptosis
uah04350  TGF-beta signaling pathway
uah04380  Osteoclast differentiation
uah04612  Antigen processing and presentation
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04940  Type I diabetes mellitus
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05322  Systemic lupus erythematosus
uah05323  Rheumatoid arthritis
uah05330  Allograft rejection
uah05332  Graft-versus-host disease
uah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    113256304 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    113256304 (IFNG)
   04630 Jak-STAT signaling pathway
    113256304 (IFNG)
   04066 HIF-1 signaling pathway
    113256304 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256304 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113256304 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113256304 (IFNG)
   04612 Antigen processing and presentation
    113256304 (IFNG)
   04660 T cell receptor signaling pathway
    113256304 (IFNG)
   04658 Th1 and Th2 cell differentiation
    113256304 (IFNG)
   04659 Th17 cell differentiation
    113256304 (IFNG)
   04657 IL-17 signaling pathway
    113256304 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113256304 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256304 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113256304 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    113256304 (IFNG)
   05323 Rheumatoid arthritis
    113256304 (IFNG)
   05321 Inflammatory bowel disease (IBD)
    113256304 (IFNG)
   05330 Allograft rejection
    113256304 (IFNG)
   05332 Graft-versus-host disease
    113256304 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    113256304 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113256304 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113256304 (IFNG)
  09172 Infectious disease: viral
   05164 Influenza A
    113256304 (IFNG)
   05160 Hepatitis C
    113256304 (IFNG)
   05168 Herpes simplex virus 1 infection
    113256304 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113256304 (IFNG)
   05144 Malaria
    113256304 (IFNG)
   05145 Toxoplasmosis
    113256304 (IFNG)
   05140 Leishmaniasis
    113256304 (IFNG)
   05142 Chagas disease (American trypanosomiasis)
    113256304 (IFNG)
   05143 African trypanosomiasis
    113256304 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:uah03051]
    113256304 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113256304 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113256304 (IFNG)
Proteasome [BR:uah03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113256304 (IFNG)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113256304 (IFNG)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113256304 (IFNG)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 113256304
NCBI-ProteinID: XP_026355871
UniProt: A0A3Q7V3L2
LinkDB
Position
Unknown
AA seq 166 aa
MNYTSYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWR
EESDKTIIQSQIVSFYLKLFENFKDNQVIQRSMDTIKEDMLFKFFNSSTSKRSDFLKLIQ
IPVNDMQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaattatacaagctatatcttagctttccagctttgtgtgattttgtgttcttctggc
tattactgtcaggccatgttttttaaagaaatagaaaacctgaaggaatattttaatgca
agtaatccagatgtagcagatggtggccctcttttcttagatattttgaagaactggaga
gaggagagtgacaaaacgatcattcaaagccaaatcgtctccttctacttgaaactgttc
gaaaactttaaagataaccaggtcattcaaaggagcatggacaccatcaaggaggacatg
cttttcaagttcttcaacagcagtaccagtaagcggagtgacttccttaagctgattcaa
attcccgtgaatgatatgcaggttcagcgcaaagcgataaatgaactcatcaaagtgatg
aatgatctctcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgtttcga
ggccgcagagcatcgaaataa

KEGG   Ursus arctos horribilis: 113256421
Entry
113256421         CDS       T05909                                 

Gene name
IL23A
Definition
(RefSeq) interleukin-23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04659  Th17 cell differentiation
uah05133  Pertussis
uah05152  Tuberculosis
uah05200  Pathways in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113256421 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113256421 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113256421 (IL23A)
   04659 Th17 cell differentiation
    113256421 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113256421 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113256421 (IL23A)
   05321 Inflammatory bowel disease (IBD)
    113256421 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    113256421 (IL23A)
   05152 Tuberculosis
    113256421 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113256421 (IL23A)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113256421 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 113256421
NCBI-ProteinID: XP_026356047
UniProt: A0A3Q7X098
LinkDB
Position
Unknown
AA seq 190 aa
MLGSRAVMLLLLLLWGAQTRAVPAGGRPAWVQGQQLSQRLCTLAWSAHPPMGQVDLPREE
GDDETTDEVPRIQCGDGCDPQGLRDNSQFCLQRIHQGLVFYEKLLGSDIFTGEPSLLPDG
PVGQLHASLLGLRQLLQPEGHHRETEQTPSPSPSQPWQRLLLRFKILRSLQAFVAVAARV
FAHGAATLSP
NT seq 573 nt   +upstreamnt  +downstreamnt
atgctggggagcagggctgtgatgctgcttctgctgctgctctggggggctcagacccgg
gctgtgcctgcgggcggtcgccctgcctgggttcagggccagcagctctcacagaggctc
tgcacgctggcctggagcgcacatccgccgatgggacaggtggacctaccaagagaagag
ggagatgacgagactacagatgaggtcccccgcatccagtgtggggatggctgtgatccc
caaggactcagagacaacagtcagttctgcttacaaaggatccaccagggcctggttttt
tatgagaagctgctgggctcagacattttcacaggggagccttctctacttcccgatggc
cctgtgggccagcttcacgcctccctcctgggccttaggcaacttttgcagcctgagggt
caccacagagagactgaacaaactccaagccccagccccagccagccatggcagcgcctc
cttctccgcttcaagatccttcgcagcctccaggcctttgtggctgtagctgctcgggtc
tttgcccacggagcagcaaccctgagcccctaa

KEGG   Ursus arctos horribilis: 113258218
Entry
113258218         CDS       T05909                                 

Definition
(RefSeq) interferon lambda-1-like
  KO
K05447  interferon lambda 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113258218
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113258218
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113258218
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113258218
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 113258218
NCBI-ProteinID: XP_026358656
UniProt: A0A3Q7VC28
LinkDB
Position
Unknown
AA seq 190 aa
MAPAWVLVLVTVLLGLVRAGPVPTSKPTTTKRGCHMDRFLSLSPRELEAFKKAKDALEES
LSPKNWSCSSRLFPRAWDLRLLQAWERPVALEAELDLTLKVLGDMADSSLGAVLDQPLRM
LRHIHAELQACAPAQPTAGPRPRGRLHHWLHRLQKAPKESQGCLEASITFNLFRLLTRDL
KCVASGDLCV
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctccagcgtgggtcctggtgctggtgaccgtgctgctgggcttggtccgagcaggc
cctgtccctacttccaaacccaccacgaccaagaggggctgccacatggacaggttcctg
tctctgtcaccgagggagctagaagccttcaagaaggccaaggatgccttagaagagtcg
ctctcgccgaagaactggagctgcagctctcgcctcttccccagggcctgggacctgaga
ctactgcaggcctgggagcgccctgtggccttggaggcagagctggacttgacgctgaaa
gtcctgggcgacatggctgactcgtccctgggggccgtcctggaccagcccctccgcatg
ctgcgccacatccacgccgagctccaggcttgcgccccggctcagcccacagcaggaccc
agaccccgtggccgcctccaccactggctgcaccggctccagaaggccccaaaggagtcc
cagggctgcctcgaggcctccatcaccttcaacctcttccgcctcctcacccgggacctg
aaatgtgtcgccagtggagacctgtgcgtctga

KEGG   Ursus arctos horribilis: 113260289
Entry
113260289         CDS       T05909                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04622  RIG-I-like receptor signaling pathway
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260289 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260289 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    113260289 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260289 (IFNE)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260289 (IFNE)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260289
NCBI-ProteinID: XP_026361779
UniProt: A0A3Q7X5I1
LinkDB
Position
Unknown
AA seq 204 aa
MIPKHFFEIVLVLLASSTLFSLELKLALFQQRVNRESLRLLNKLQKASIQQCLPHRTNFL
LPQQSVTRRRYQRGQALGILHEMLQQIFNLFRADMSLDGWEESHMENFLTELHQQLEHLE
ALRGLQAEQNSSENPRLQVKMYFRRIHDYLENQEYSSCSWTIVRVEISRCLFFAFQLIRE
LSKQGMDSFKNVEQEPTASLKSIG
NT seq 615 nt   +upstreamnt  +downstreamnt
atgattcccaagcatttctttgaaatcgtgttggtgctgttggcctcttccactctcttc
tccctcgaactgaaactggctctcttccaacaaagagtaaacagagagagtttacgactc
ttgaataaattgcaaaaagcatcaattcagcagtgtctaccacacaggacaaacttccta
cttccccagcagtctgtgactcgtcgccggtaccagagagggcaagccctgggcattctt
catgagatgcttcagcagatcttcaacctcttcagggcagatatgtctctggatggctgg
gaggaaagccacatggagaatttcctcactgaacttcatcaacagctggaacacctagaa
gcgcttagaggcctgcaagcagagcagaacagtagtgagaaccctaggttgcaggttaaa
atgtacttccggaggatccatgattacctggaaaaccaggagtacagcagctgctcctgg
accattgttcgagtagaaatcagccggtgtctgttctttgctttccaactgataagagag
ctaagcaaacaaggaatggattccttcaagaatgtggaacaagagccaactgcaagcctt
aaaagcatagggtag

KEGG   Ursus arctos horribilis: 113260290
Entry
113260290         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260290
   04151 PI3K-Akt signaling pathway
    113260290
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260290
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260290
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260290
   04621 NOD-like receptor signaling pathway
    113260290
   04622 RIG-I-like receptor signaling pathway
    113260290
   04623 Cytosolic DNA-sensing pathway
    113260290
   04650 Natural killer cell mediated cytotoxicity
    113260290
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260290
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260290
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260290
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260290
   05162 Measles
    113260290
   05164 Influenza A
    113260290
   05161 Hepatitis B
    113260290
   05160 Hepatitis C
    113260290
   05168 Herpes simplex virus 1 infection
    113260290
   05163 Human cytomegalovirus infection
    113260290
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260290
   05169 Epstein-Barr virus infection
    113260290
   05165 Human papillomavirus infection
    113260290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260290
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260290
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260290
NCBI-ProteinID: XP_026361780
UniProt: A0A3Q7WAA5
LinkDB
Position
Unknown
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTRDFA
FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSALE
ACPMQAARVGETPAMNVDSILRNYFQRISLYLQEKQYSPCAWETVRAEITSSLFSSTILQ
EGLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacgtgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg
catgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgccctggaa
gcctgtcccatgcaggcggcgcgagtgggagagactcccgccatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcccttgt
gcctgggagactgtcagagcagaaatcacgagctccttgttttcttcaacgatcttgcaa
gaaggactaaggcgcaagaaatga

KEGG   Ursus arctos horribilis: 113260291
Entry
113260291         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260291
   04151 PI3K-Akt signaling pathway
    113260291
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260291
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260291
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260291
   04621 NOD-like receptor signaling pathway
    113260291
   04622 RIG-I-like receptor signaling pathway
    113260291
   04623 Cytosolic DNA-sensing pathway
    113260291
   04650 Natural killer cell mediated cytotoxicity
    113260291
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260291
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260291
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260291
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260291
   05162 Measles
    113260291
   05164 Influenza A
    113260291
   05161 Hepatitis B
    113260291
   05160 Hepatitis C
    113260291
   05168 Herpes simplex virus 1 infection
    113260291
   05163 Human cytomegalovirus infection
    113260291
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260291
   05169 Epstein-Barr virus infection
    113260291
   05165 Human papillomavirus infection
    113260291
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260291
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260291
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260291
NCBI-ProteinID: XP_026361781
UniProt: A0A3Q7VL96
LinkDB
Position
Unknown
AA seq 187 aa
MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTHDFA
FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSVLE
ACPMQAARVGETPGMNVDSILRNYFQRISLYLQAKQYSPCAWETVRAEIMKPLFSSTILQ
EGLRRKK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacatgactttgcc
ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg
catgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg
aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa
gcctgtcccatgcaggcggcgcgagtgggagagactcccggcatgaatgtggactccatc
ctgaggaactacttccaaagaatctccctctacctgcaagcgaagcaatacagcccttgt
gcctgggagactgtcagagcagaaatcatgaaacccttgttttcatcaacaatcttgcaa
gaaggactaaggcgcaagaaatga

KEGG   Ursus arctos horribilis: 113260293
Entry
113260293         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-1/2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260293
   04151 PI3K-Akt signaling pathway
    113260293
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260293
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260293
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260293
   04621 NOD-like receptor signaling pathway
    113260293
   04622 RIG-I-like receptor signaling pathway
    113260293
   04623 Cytosolic DNA-sensing pathway
    113260293
   04650 Natural killer cell mediated cytotoxicity
    113260293
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260293
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260293
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260293
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260293
   05162 Measles
    113260293
   05164 Influenza A
    113260293
   05161 Hepatitis B
    113260293
   05160 Hepatitis C
    113260293
   05168 Herpes simplex virus 1 infection
    113260293
   05163 Human cytomegalovirus infection
    113260293
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260293
   05169 Epstein-Barr virus infection
    113260293
   05165 Human papillomavirus infection
    113260293
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260293
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260293
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260293
NCBI-ProteinID: XP_026361783
UniProt: A0A3Q7WJP5
LinkDB
Position
Unknown
AA seq 228 aa
METDVFPFKRAHKARCSENLEPRFPDLPTPARPAASAGSPMALPFSFLVALVVLSGNSLC
SLGCDLPQNHGLFAWRALTLLGQMKRISLISCVHKYTHDFAFPKEVVDGKQLQKAQALSV
VHVMNQKIFHIFCTEASSAAWNTTLLEEFCSGLSEQLSVLEACPMQAARVGETPGMNVDS
ILRNYFQRISLYLQEKQYSPCAWETVRAEIMKPFSSSTTLQERLRGKK
NT seq 687 nt   +upstreamnt  +downstreamnt
atggaaactgatgtgttcccatttaagagggctcacaaggcaagatgctcagagaaccta
gagccacggttcccagacttgcccaccccagccaggccagcagcctctgcaggatcccca
atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc
tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc
ctgggacaaatgaagagaatctcccttatctcttgtgtacacaagtacacacatgacttt
gccttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtc
gtgcatgtgatgaaccagaagatcttccacatcttctgcacagaggcctcatctgctgct
tggaacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctg
gaagcctgtcccatgcaggcggcgcgagtgggagagactcccggcatgaatgtggactcc
atcctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagccct
tgtgcctgggagactgtcagagcagaaatcatgaaacccttctcttcatcaacaaccttg
caagaaaggttaaggggcaagaaatga

KEGG   Ursus arctos horribilis: 113260294
Entry
113260294         CDS       T05909                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
uah05200  Pathways in cancer
uah05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260294
   04151 PI3K-Akt signaling pathway
    113260294
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260294
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260294
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260294
   04621 NOD-like receptor signaling pathway
    113260294
   04622 RIG-I-like receptor signaling pathway
    113260294
   04623 Cytosolic DNA-sensing pathway
    113260294
   04650 Natural killer cell mediated cytotoxicity
    113260294
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113260294
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113260294
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    113260294
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260294
   05162 Measles
    113260294
   05164 Influenza A
    113260294
   05161 Hepatitis B
    113260294
   05160 Hepatitis C
    113260294
   05168 Herpes simplex virus 1 infection
    113260294
   05163 Human cytomegalovirus infection
    113260294
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260294
   05169 Epstein-Barr virus infection
    113260294
   05165 Human papillomavirus infection
    113260294
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260294
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260294
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 113260294
NCBI-ProteinID: XP_026361784
UniProt: A0A3Q7X5I4
LinkDB
Position
Unknown
AA seq 183 aa
MALSISVLLALVMLCSSPACSLDCTLRPSHPEPFVLLSQMERISILSCLKDRTDFSFPQM
LVDGSKFEKTEATAVMHEMFQQIFNLFSQSGSLVAWDETPLDKFLAGLHQQLEDLETCLE
EEKNVEQLLLGSENSRLAVKRYFHGIGLYLEKKKYSRCAWEVVRVEIRRCLFFVNELAGK
LRK
NT seq 552 nt   +upstreamnt  +downstreamnt
atggccctctcgatctctgtgctgctggccctggtgatgctgtgctccagccctgcctgc
tctttggactgcaccctgcgtccaagccatccagaacccttcgtgctgttgagtcaaatg
gagagaatctccattctatcctgtctgaaggataggactgacttcagctttcctcagatg
cttgtggatgggagcaagtttgagaagacagaagccacagctgtcatgcatgagatgttc
cagcagatcttcaacctcttcagccaaagtggctctcttgtggcttgggatgagacccca
ctagacaaattcctcgctggacttcatcagcagctggaagacctggagacatgtttggag
gaggaaaagaatgtggaacagttactcctgggaagcgagaactccagactggctgtgaag
agatacttccatggaatcggtctctatcttgaaaagaaaaaatacagccgctgtgcctgg
gaggttgtcagggtggaaatcagaaggtgcttgttcttcgttaacgagctcgcagggaaa
ctcaggaaataa

KEGG   Ursus arctos horribilis: 113260295
Entry
113260295         CDS       T05909                                 

Gene name
IFNB1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04217  Necroptosis
uah04380  Osteoclast differentiation
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04630  Jak-STAT signaling pathway
uah04650  Natural killer cell mediated cytotoxicity
uah04668  TNF signaling pathway
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05152  Tuberculosis
uah05160  Hepatitis C
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05165  Human papillomavirus infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260295 (IFNB1)
   04668 TNF signaling pathway
    113260295 (IFNB1)
   04151 PI3K-Akt signaling pathway
    113260295 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260295 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113260295 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113260295 (IFNB1)
   04621 NOD-like receptor signaling pathway
    113260295 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    113260295 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    113260295 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    113260295 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113260295 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    113260295 (IFNB1)
   05152 Tuberculosis
    113260295 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    113260295 (IFNB1)
   05162 Measles
    113260295 (IFNB1)
   05164 Influenza A
    113260295 (IFNB1)
   05161 Hepatitis B
    113260295 (IFNB1)
   05160 Hepatitis C
    113260295 (IFNB1)
   05168 Herpes simplex virus 1 infection
    113260295 (IFNB1)
   05163 Human cytomegalovirus infection
    113260295 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113260295 (IFNB1)
   05169 Epstein-Barr virus infection
    113260295 (IFNB1)
   05165 Human papillomavirus infection
    113260295 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    113260295 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260295 (IFNB1)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260295 (IFNB1)
SSDB
Motif
Pfam: Interferon VitK2_biosynth
Other DBs
NCBI-GeneID: 113260295
NCBI-ProteinID: XP_026361786
UniProt: A0A3Q7VLA1
LinkDB
Position
Unknown
AA seq 186 aa
MTSRCILQTALLVYFSTTVLAVNYDLLRFQLSSSSVECQELLLQLNGTTKDCLKDRMNFK
FPEEIEKSQQFQKEDFILVTLEMFQKTSDIFRRNLSSTGWNEIIVKNLLETLHWQKEHLE
EILEKIMEEENFTWDDRTLLHLKKYYLRIVRYLKAKEYSICAWTIVQAEMLRSFFFLDKL
TDYLPN
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccagcaggtgcatcctccaaaccgctctcctggtgtatttctccaccacggttctc
gccgtgaactacgacttgcttcgattccaactaagcagcagcagtgtggagtgccaggag
ctccttctgcagttgaatggaacgactaaagattgcctcaaggaccggatgaacttcaag
ttccctgaggagatcgagaaatcccagcagttccagaaggaggacttcatattggtcacc
cttgagatgttccagaagacctctgatattttcaggagaaatctctcgagcacagggtgg
aatgagatcattgtcaagaacctccttgagacgctccattggcagaaggaacatctggag
gaaatcctggagaaaatcatggaggaggaaaacttcacctgggacgacaggacccttctg
cacctgaagaaatattatctaaggatcgtgcgatacctgaaggccaaggagtacagcatt
tgtgcctggacaatagtgcaagcagagatgctcaggagctttttcttccttgataaactt
acggattatctcccaaactga

KEGG   Ursus arctos horribilis: 113260554
Entry
113260554         CDS       T05909                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04622  RIG-I-like receptor signaling pathway
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113260554 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113260554 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    113260554 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113260554 (IFNK)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interferons
   113260554 (IFNK)
SSDB
Motif
Pfam: Interferon Tsi6
Other DBs
NCBI-GeneID: 113260554
NCBI-ProteinID: XP_026362211
UniProt: A0A3Q7VME5
LinkDB
Position
Unknown
AA seq 208 aa
MSTKPDVIRKCLQSACLVGLLVTGILSLDCNLLHFHLRKVTWQNLRLLSSTSSSFPVECL
RETKAFELPQEILSHTQPAKRYIKEAFYEMSIQAFNIFSQYTFTSTWEKDYLKQIQIGLD
QQLQYLEQCLEEEEKEKEDSKELEEDGMNWSGALVPQLGNLELRRYFNRIDNFLKEKKYS
HCAWEIIRVEIRRCFYYFQKFAALLRKK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgagcactaagcctgatgtgattcggaagtgtttgcagtctgcatgccttgtgggtctg
ctcgtcactggcatcctctctctggactgtaacttgctgcattttcacctgaggaaagtc
acctggcaaaatctgagacttctgagcagtacgagcagttcctttcctgtagagtgcctc
agggaaaccaaagcttttgagttgccccaagagatcctatcacacacccagcctgccaaa
aggtacatcaaggaggccttctatgaaatgtccatacaggccttcaacatcttcagtcag
tacaccttcacatccacttgggaaaaggactacctgaaacaaatccaaattggactcgac
cagcagttgcagtacttggaacaatgcttggaggaagaggagaaagaaaaggaagactcg
aaagagttggaagaggatgggatgaactggtcaggagctctggtcccccagctgggcaac
ctagaactgaggagatatttcaataggatagacaactttctgaaagaaaaaaaatacagt
cattgtgcctgggaaatcatccgagtggaaatcagaaggtgtttctactactttcagaaa
tttgcagcactgctcaggaagaaataa

KEGG   Ursus arctos horribilis: 113261280
Entry
113261280         CDS       T05909                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
uah  Ursus arctos horribilis
Pathway
uah01521  EGFR tyrosine kinase inhibitor resistance
uah01523  Antifolate resistance
uah04060  Cytokine-cytokine receptor interaction
uah04061  Viral protein interaction with cytokine and cytokine receptor
uah04066  HIF-1 signaling pathway
uah04068  FoxO signaling pathway
uah04151  PI3K-Akt signaling pathway
uah04218  Cellular senescence
uah04620  Toll-like receptor signaling pathway
uah04621  NOD-like receptor signaling pathway
uah04623  Cytosolic DNA-sensing pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04657  IL-17 signaling pathway
uah04659  Th17 cell differentiation
uah04668  TNF signaling pathway
uah04672  Intestinal immune network for IgA production
uah04931  Insulin resistance
uah04932  Non-alcoholic fatty liver disease (NAFLD)
uah04933  AGE-RAGE signaling pathway in diabetic complications
uah05010  Alzheimer disease
uah05020  Prion diseases
uah05132  Salmonella infection
uah05133  Pertussis
uah05134  Legionellosis
uah05135  Yersinia infection
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05144  Malaria
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05161  Hepatitis B
uah05162  Measles
uah05163  Human cytomegalovirus infection
uah05164  Influenza A
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05168  Herpes simplex virus 1 infection
uah05169  Epstein-Barr virus infection
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05323  Rheumatoid arthritis
uah05332  Graft-versus-host disease
uah05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261280 (IL6)
   04668 TNF signaling pathway
    113261280 (IL6)
   04066 HIF-1 signaling pathway
    113261280 (IL6)
   04068 FoxO signaling pathway
    113261280 (IL6)
   04151 PI3K-Akt signaling pathway
    113261280 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261280 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    113261280 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    113261280 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261280 (IL6)
   04620 Toll-like receptor signaling pathway
    113261280 (IL6)
   04621 NOD-like receptor signaling pathway
    113261280 (IL6)
   04623 Cytosolic DNA-sensing pathway
    113261280 (IL6)
   04625 C-type lectin receptor signaling pathway
    113261280 (IL6)
   04659 Th17 cell differentiation
    113261280 (IL6)
   04657 IL-17 signaling pathway
    113261280 (IL6)
   04672 Intestinal immune network for IgA production
    113261280 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261280 (IL6)
   05202 Transcriptional misregulation in cancer
    113261280 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113261280 (IL6)
   05321 Inflammatory bowel disease (IBD)
    113261280 (IL6)
   05332 Graft-versus-host disease
    113261280 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113261280 (IL6)
   05020 Prion diseases
    113261280 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    113261280 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    113261280 (IL6)
   04931 Insulin resistance
    113261280 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    113261280 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113261280 (IL6)
   05135 Yersinia infection
    113261280 (IL6)
   05133 Pertussis
    113261280 (IL6)
   05134 Legionellosis
    113261280 (IL6)
   05152 Tuberculosis
    113261280 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113261280 (IL6)
   05162 Measles
    113261280 (IL6)
   05164 Influenza A
    113261280 (IL6)
   05161 Hepatitis B
    113261280 (IL6)
   05168 Herpes simplex virus 1 infection
    113261280 (IL6)
   05163 Human cytomegalovirus infection
    113261280 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113261280 (IL6)
   05169 Epstein-Barr virus infection
    113261280 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113261280 (IL6)
   05144 Malaria
    113261280 (IL6)
   05142 Chagas disease (American trypanosomiasis)
    113261280 (IL6)
   05143 African trypanosomiasis
    113261280 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113261280 (IL6)
   01523 Antifolate resistance
    113261280 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261280 (IL6)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261280 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL11 IL23
Other DBs
NCBI-GeneID: 113261280
NCBI-ProteinID: XP_026363207
UniProt: A0A3Q7XKP5
LinkDB
Position
Unknown
AA seq 240 aa
MRLGMSEAHSALEPTRNERELHLPSRTPAMNSLSTSAFSPVAFSLGLLLVMATAFPTPGH
LGRDSKDEATSNRPPLISADKMEIIKYILGRISALKKEMCDKYNKCEDSKEALAENNLHL
PKLAEKDGCFQSGFNQDTCLTRIATGLLEFQVHLKYLQANYEGDKENANSVYFSTKVLLQ
MLMEKVKNQDEVTTPDPTTDTGLQAILKSQDKWLKQTTIHLILRNLEDFLQFSLRAVRVM
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagactggggatgtctgaggctcattctgccctcgagcccaccaggaacgaaagagag
ctccatctgccctccaggaccccagctatgaactccctctccacaagcgccttcagtcca
gttgccttctccctggggctgctcctggtgatggctactgctttccctaccccgggacac
ctgggaagagattccaaagatgaggccacctcaaatagaccaccactcatctctgcagac
aaaatggaaatcattaaatacatcctcggcagaatctctgcactgaaaaaggagatgtgt
gacaagtataacaagtgtgaagacagcaaggaggcactggcagaaaacaacttacatctt
ccaaaactggcagaaaaggacggatgcttccaatctgggttcaatcaggacacctgcctg
acaagaatcgctaccggtcttctggagtttcaggtacacctgaaatacctccaggccaac
tatgaaggtgataaggaaaatgccaactctgtgtacttcagtaccaaagtcctgctccag
atgctgatggaaaaggtaaagaatcaggatgaagtgaccaccccagaccccaccacagac
accggcctgcaggctatcctgaagtcgcaggacaagtggctgaagcaaacaacaattcac
ctcatcctgcggaaccttgaggatttcctgcagttcagcctgagggcagtgcgggtcatg
tag

KEGG   Ursus arctos horribilis: 113261494
Entry
113261494         CDS       T05909                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah05310  Asthma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261494 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261494 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    113261494 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261494 (IL9)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261494 (IL9)
SSDB
Motif
Pfam: Dynamin_M
Other DBs
NCBI-GeneID: 113261494
NCBI-ProteinID: XP_026363393
UniProt: A0A3Q7WP59
LinkDB
Position
Unknown
AA seq 116 aa
MTLPTVVLASVLLLCSATSQKCTTFTEILDVTYLIDKLQDNCTTVCFQEGLSQMTNSTAE
TRYPLIFNRVKKTVLKNKCQLFSCEQPCNQTTTGNTLTFLQRLREVLQKQRAMDKV
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaccctgcccaccgtggtccttgcctctgtcctgctcctctgctccgcgaccagccag
aagtgtacgacctttacagagatcctagacgtcacgtacctcattgacaaactgcaggac
aactgcaccacggtatgcttccaggaaggtctgtcccagatgaccaactccacagcggaa
acaagatatcccctgattttcaatcgagtaaaaaaaacagtcttaaagaacaagtgccag
ttgttttcctgtgaacagccatgtaaccaaaccacaacaggcaacacgctgacgtttctg
cagagactccgggaagttctccagaaacaaagggcaatggacaaagtatga

KEGG   Ursus arctos horribilis: 113261702
Entry
113261702         CDS       T05909                                 

Gene name
CSF2
Definition
(RefSeq) granulocyte-macrophage colony-stimulating factor isoform X1
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04650  Natural killer cell mediated cytotoxicity
uah04657  IL-17 signaling pathway
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04668  TNF signaling pathway
uah05146  Amoebiasis
uah05166  Human T-cell leukemia virus 1 infection
uah05167  Kaposi sarcoma-associated herpesvirus infection
uah05202  Transcriptional misregulation in cancer
uah05221  Acute myeloid leukemia
uah05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261702 (CSF2)
   04668 TNF signaling pathway
    113261702 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261702 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261702 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    113261702 (CSF2)
   04660 T cell receptor signaling pathway
    113261702 (CSF2)
   04657 IL-17 signaling pathway
    113261702 (CSF2)
   04664 Fc epsilon RI signaling pathway
    113261702 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    113261702 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    113261702 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    113261702 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113261702 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    113261702 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113261702 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:uah03019]
    113261702 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261702 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113261702 (CSF2)
Messenger RNA biogenesis [BR:uah03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     113261702 (CSF2)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113261702 (CSF2)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113261702 (CSF2)
SSDB
Motif
Pfam: GM_CSF IL4 FIBP
Other DBs
NCBI-GeneID: 113261702
NCBI-ProteinID: XP_026363698
UniProt: A0A3Q7WQ06
LinkDB
Position
Unknown
AA seq 277 aa
MWLQNLLFLGTVVYSISAPTSSPSPVTRPSQHVDAIQEALRLLNNSSDDTAVMNKAVKVV
SGMFDRQEPTCLQTRLRLYKEGLPDSLISLRKPLTLMAKHYEKHCLPTPKCCQAQAQIIL
ELRSSPTMYLYVFLACALWGSENHCASMMTANVSAYDNHTAVCAEIQKELSADNIIYNGS
FKRPQNTSEEPCYGEFTKDFISTLKELTKSNEHDRHIRKVYKDMKELTRICPKLKPTESP
KNCTTEESNFSQFKEALQSVVISIEGWKSCKSIKSSL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgctttttctgggcactgtggtctacagcatctccgcacccacc
agctcgcccagccctgtcactcgaccctctcagcacgtggatgccatccaagaggccctg
agacttctgaacaatagtagtgatgatactgctgtgatgaataaagcagtaaaagtcgtc
tctggaatgtttgaccgccaggagccgacatgcctgcagacccgcctacggctgtacaag
gagggcctgcctgacagcctcatcagcctcaggaaacccttaaccctgatggccaagcac
tatgagaaacactgcctccctaccccgaaatgctgccaagcccaggctcagatcatcttg
gagctacgctcaagtcctaccatgtacctctacgtgttcctggcttgtgcactctgggga
tcagaaaaccattgcgcctccatgatgacagccaacgtgtctgcctacgacaaccacact
gcagtctgtgctgaaattcagaaagaactctcagctgacaacattatatacaacggttcc
ttcaaaaggccccagaacaccagtgaggagccctgctatggggagtttacgaaggacttc
atctccaccctgaaggaacttacgaaatctaacgagcatgaccgtcacataagaaaggtt
tataaggacatgaaagaactcaccagaatctgcccaaagctgaaaccaacagaatcaccc
aagaactgtactactgaggaaagtaacttctcacagttcaaggaagccttacagagtgtt
gtcatatccatagaaggatggaaatcctgtaaaagcatcaagagcagtctctga

KEGG   Ursus arctos horribilis: 113261704
Entry
113261704         CDS       T05909                                 

Definition
(RefSeq) interleukin-3-like
  KO
K04736  interleukin 3
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04210  Apoptosis
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04664  Fc epsilon RI signaling pathway
uah05200  Pathways in cancer
uah05202  Transcriptional misregulation in cancer
uah05221  Acute myeloid leukemia
uah05310  Asthma
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261704
   04151 PI3K-Akt signaling pathway
    113261704
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261704
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113261704
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261704
   04664 Fc epsilon RI signaling pathway
    113261704
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261704
   05202 Transcriptional misregulation in cancer
    113261704
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    113261704
  09163 Immune disease
   05310 Asthma
    113261704
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261704
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113261704
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261704
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113261704
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 113261704
NCBI-ProteinID: XP_026363707
UniProt: A0A3Q7XLV0
LinkDB
Position
Unknown
AA seq 142 aa
MHSLPILHVLLLLLGLRAPMAQGRSLSTYQPKQYFKMISEIMDILNNSPSPSEETLDPNE
TSTLLNTTLLRPNLDAFLNATKNFYNSESLIWKNLKEFLPLLPTPTPRGQPISIENNLGD
FQKKLKKYLEALDNFLNFKNKQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcacagcctccccatcttgcacgttctcctgctcctgcttggactccgagccccaatg
gcacaggggcgctccttgtccacataccagcctaagcaatacttcaagatgatcagtgaa
attatggacatcttaaacaattcaccctcaccttcagaagaaaccttggacccaaatgag
acaagcaccctgctgaacactacccttctgaggccaaacctggatgcattcttgaatgct
accaaaaatttctacaacagtgaatcgctaatctggaaaaatcttaaggaattcctgcca
ctcctgcccactcccacacccagggggcaaccaatctctatcgagaataacttgggtgat
ttccaaaagaagctgaaaaagtatctggaagcccttgacaactttctgaatttcaagaac
aagcaatga

KEGG   Ursus arctos horribilis: 113261714
Entry
113261714         CDS       T05909                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04672  Intestinal immune network for IgA production
uah05200  Pathways in cancer
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261714 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261714 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261714 (IL5)
   04660 T cell receptor signaling pathway
    113261714 (IL5)
   04658 Th1 and Th2 cell differentiation
    113261714 (IL5)
   04657 IL-17 signaling pathway
    113261714 (IL5)
   04664 Fc epsilon RI signaling pathway
    113261714 (IL5)
   04672 Intestinal immune network for IgA production
    113261714 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261714 (IL5)
  09163 Immune disease
   05310 Asthma
    113261714 (IL5)
   05320 Autoimmune thyroid disease
    113261714 (IL5)
   05321 Inflammatory bowel disease (IBD)
    113261714 (IL5)
   05330 Allograft rejection
    113261714 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261714 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113261714 (IL5)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261714 (IL5)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113261714 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 113261714
NCBI-ProteinID: XP_026363733
UniProt: A0A3Q7WQ35
LinkDB
Position
Unknown
AA seq 134 aa
MRMLLHLSLLALGAAYVSVTAAESTMNGLVAETLTLLSAHRTLLIGDGNLMIPTPEHKNH
QLCIEEVFQGIDILKNRTAQGEAVDKLFRNLSLIKQHIEHQKKKCAGERWRVKKFLDYLQ
VFLGVINTEWTTES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact
gctgcagaaagtaccatgaatggactggtggcagagaccttgacactgctctctgctcat
cgaactctgctgataggagatgggaacctgatgattcctactcctgaacataaaaatcac
caactgtgcattgaagaagtctttcagggcatagacatattgaagaaccgaactgcacaa
ggggaggctgtggataaactattccggaacttgtctttaataaaacaacacatagagcac
caaaaaaaaaagtgtgcaggagagagatggagagtaaaaaagttcctagactacctgcaa
gtgtttcttggtgtcataaacaccgagtggacaacagaaagttga

KEGG   Ursus arctos horribilis: 113261716
Entry
113261716         CDS       T05909                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04151  PI3K-Akt signaling pathway
uah04630  Jak-STAT signaling pathway
uah04640  Hematopoietic cell lineage
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04659  Th17 cell differentiation
uah04660  T cell receptor signaling pathway
uah04664  Fc epsilon RI signaling pathway
uah04672  Intestinal immune network for IgA production
uah05140  Leishmaniasis
uah05200  Pathways in cancer
uah05310  Asthma
uah05320  Autoimmune thyroid disease
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261716 (IL4)
   04151 PI3K-Akt signaling pathway
    113261716 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261716 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113261716 (IL4)
   04660 T cell receptor signaling pathway
    113261716 (IL4)
   04658 Th1 and Th2 cell differentiation
    113261716 (IL4)
   04659 Th17 cell differentiation
    113261716 (IL4)
   04657 IL-17 signaling pathway
    113261716 (IL4)
   04664 Fc epsilon RI signaling pathway
    113261716 (IL4)
   04672 Intestinal immune network for IgA production
    113261716 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261716 (IL4)
  09163 Immune disease
   05310 Asthma
    113261716 (IL4)
   05320 Autoimmune thyroid disease
    113261716 (IL4)
   05321 Inflammatory bowel disease (IBD)
    113261716 (IL4)
   05330 Allograft rejection
    113261716 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    113261716 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261716 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113261716 (IL4)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261716 (IL4)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113261716 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 113261716
NCBI-ProteinID: XP_026363735
UniProt: A0A3Q7WFH7
LinkDB
Position
Unknown
AA seq 132 aa
MGLTSQLIPALVCLLALTSTFVHGHNFSITIKEIIKTLNILTARNDTCMELTVTNIFAAP
KNTTDTETFCRATTVLRQLSTHSCSNKLLGGLHRNLKTMANMTCSVNEVKKSTLRDFLER
LKAIVQRKYYRH
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgattccagctctggtctgcttactagcactcaccagcacc
ttcgtccacggccataacttcagtattaccattaaagagatcatcaaaacgttgaacatc
ctcacagcgagaaacgacacgtgcatggagctgaccgtcaccaacatcttcgctgcccca
aagaacacaaccgatacggaaaccttctgcagagccacaactgtgcttcggcagctctct
acacacagctgctccaacaaactcctcggagggcttcacaggaacctcaagacaatggca
aacatgacctgttcggtgaatgaagtcaagaagagtacgctgagagacttcttggaaagg
ctaaaagcgatcgtgcaaaggaaatactacaggcactga

KEGG   Ursus arctos horribilis: 113261717
Entry
113261717         CDS       T05909                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13
  KO
K05435  interleukin 13
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
uah04657  IL-17 signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04664  Fc epsilon RI signaling pathway
uah05200  Pathways in cancer
uah05310  Asthma
uah05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113261717 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113261717 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    113261717 (IL13)
   04657 IL-17 signaling pathway
    113261717 (IL13)
   04664 Fc epsilon RI signaling pathway
    113261717 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113261717 (IL13)
  09163 Immune disease
   05310 Asthma
    113261717 (IL13)
   05321 Inflammatory bowel disease (IBD)
    113261717 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113261717 (IL13)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113261717 (IL13)
SSDB
Motif
Pfam: IL13 GCIP
Other DBs
NCBI-GeneID: 113261717
NCBI-ProteinID: XP_026363736
UniProt: A0A3Q7VRJ9
LinkDB
Position
Unknown
AA seq 131 aa
MALWLTVVIALTCLGGLASPGPVPSHKALRELIEELVNITQNQASLCNGSMVWSVNQTAS
MYCAALESLLNVSDCSAIQRTQRMLKAMCLHTPSAGHLSSLRSQDTKIEVIQLVKNLLTH
VRRHFRHGNFT
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcgctctggttgactgtggtcattgctctcacctgccttggtggccttgcctcccca
ggccctgtgccttcccacaaagccctcagggagctcattgaggaactggtcaacatcacc
cagaatcaggcgtccctctgcaatggcagcatggtgtggagcgtcaaccagaccgccagc
atgtactgcgcagctctagaatctttgctcaatgtctctgactgcagcgccatccaaagg
actcagaggatgctgaaagccatgtgccttcacactccctcggcagggcacctttccagt
ctgcgcagccaagacaccaaaattgaagtgatccagttggtgaaaaacctgctcacccat
gtacggagacattttcgccatggaaatttcacataa

KEGG   Ursus arctos horribilis: 113263879
Entry
113263879         CDS       T05909                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04620  Toll-like receptor signaling pathway
uah04622  RIG-I-like receptor signaling pathway
uah04625  C-type lectin receptor signaling pathway
uah04630  Jak-STAT signaling pathway
uah04658  Th1 and Th2 cell differentiation
uah04940  Type I diabetes mellitus
uah05133  Pertussis
uah05134  Legionellosis
uah05140  Leishmaniasis
uah05142  Chagas disease (American trypanosomiasis)
uah05143  African trypanosomiasis
uah05145  Toxoplasmosis
uah05146  Amoebiasis
uah05152  Tuberculosis
uah05162  Measles
uah05164  Influenza A
uah05168  Herpes simplex virus 1 infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05321  Inflammatory bowel disease (IBD)
uah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113263879 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113263879 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    113263879 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    113263879 (IL12B)
   04625 C-type lectin receptor signaling pathway
    113263879 (IL12B)
   04658 Th1 and Th2 cell differentiation
    113263879 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113263879 (IL12B)
   05205 Proteoglycans in cancer
    113263879 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    113263879 (IL12B)
   05330 Allograft rejection
    113263879 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113263879 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    113263879 (IL12B)
   05134 Legionellosis
    113263879 (IL12B)
   05152 Tuberculosis
    113263879 (IL12B)
  09172 Infectious disease: viral
   05162 Measles
    113263879 (IL12B)
   05164 Influenza A
    113263879 (IL12B)
   05168 Herpes simplex virus 1 infection
    113263879 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    113263879 (IL12B)
   05145 Toxoplasmosis
    113263879 (IL12B)
   05140 Leishmaniasis
    113263879 (IL12B)
   05142 Chagas disease (American trypanosomiasis)
    113263879 (IL12B)
   05143 African trypanosomiasis
    113263879 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113263879 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:uah00536]
    113263879 (IL12B)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  Interleukins
   113263879 (IL12B)
Glycosaminoglycan binding proteins [BR:uah00536]
 Heparan sulfate / Haparin
  Cytokines
   113263879 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_3 Ig_4 Ig_2 fn3 DBD_Tnp_Mut
Other DBs
NCBI-GeneID: 113263879
NCBI-ProteinID: XP_026366447
UniProt: A0A3Q7XTL8
LinkDB
Position
Unknown
AA seq 329 aa
MQPQQLVVSWFSLVLLASPLMAVWELEKNVYVVELDWHPDAPGEVVVLTCHTPEEDDITW
TSDQSSEVLGSGKTLTVQVKEFGDAGRYTCHKGGKVLSDSLLLIHKKEDGIWSTDILKEQ
KESKNRIFLKCEAKNYSGHFTCWWLTAISTDLKFSVKSSRGFSDPQGVTCGAVTLSADRV
RVDNRDYKKYTVECQEGSACPTAEESLPIEVVVDAIHKLKYENYTRSFFIRDIIKPDPPM
NLQLKPLKNSRHVEVSWEYPDTWSTPHSYFSLTFCIQGQGKNHREKKERLCVDKTSAKVT
CPREAKIRVQARDRYYSSSWSDWAAVSCT
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcagccgcagcagctggtcgtctcctggttctccctggttctgttggcatctcccctc
atggccgtatgggaactggagaaaaatgtttatgttgtagagttggactggcacccggac
gcccccggagaggtggtggtcctcacctgccatactcctgaagaggatgacatcacctgg
acctcagaccagagcagtgaagtcttaggctctggtaaaactctgaccgtccaagtcaaa
gaatttggagatgctggccggtatacctgtcataaaggaggcaaggttctgagcgattcg
ctcctgctgattcacaaaaaggaagatggaatctggtccactgatatcttaaaggaacag
aaagaatccaaaaataggatctttctaaaatgtgaggcaaagaattattctggacatttc
acctgctggtggctgacggcaatcagtactgacttgaaattcagtgtcaaaagcagcaga
ggcttctctgacccccaaggggtgacgtgtggagcagtgacactctcagcagacagggtc
agagtggacaacagggattataagaagtacacggtggagtgtcaggagggcagcgcctgc
cccacagccgaggagagcctacccatcgaggtcgtggtggacgctattcacaagctcaag
tatgaaaactacaccaggagcttcttcatcagggacatcatcaaaccggacccgcccatg
aacctgcagctgaagcccttaaaaaattctcggcatgtggaggtcagctgggaatacccc
gacacttggagcaccccgcattcctacttctccctgacattctgcatacagggccagggc
aagaaccatcgggaaaagaaagagagactctgcgtggacaagacctcggccaaggtcacg
tgccccagggaggccaagatccgcgtgcaagcccgagaccgctactacagctcatcctgg
agcgattgggcagctgtgtcctgcacttag

KEGG   Ursus arctos horribilis: 113267705
Entry
113267705         CDS       T05909                                 

Gene name
CTF1
Definition
(RefSeq) cardiotrophin-1
  KO
K05422  cardiotrophin 1
Organism
uah  Ursus arctos horribilis
Pathway
uah04060  Cytokine-cytokine receptor interaction
uah04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    113267705 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113267705 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:uah04052]
    113267705 (CTF1)
Cytokines and growth factors [BR:uah04052]
 Cytokines
  CSF and other factors
   113267705 (CTF1)
SSDB
Motif
Pfam: PRF pPIWI_RE_X
Other DBs
NCBI-GeneID: 113267705
NCBI-ProteinID: XP_026371622
UniProt: A0A3Q7Y453
LinkDB
Position
Unknown
AA seq 206 aa
MSRREGSLENPQADSSISPLSHLEAKIRQTHSLARLLTKYAEQLLQEYVQHQGDPFGLPG
FSPPRLPVAGLSSPAPGHAGLPAPERLRLDAAALSALPPLLDVVRRHQAELNPRAPRLLR
RLEDAARQARALGAAVEAVLAALGAEPREPRPEPAAAAAAATATATATDAGVFPAKVLGL
RVCGLYREWVSRTEGDLGQLVPGGPA
NT seq 621 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaaaatccacaggctgactcctcaatctcacccctt
tcgcacttggaggccaagatccgtcagacacacagccttgcccgcctcctcaccaaatac
gctgagcagctgctccaggaatatgtgcagcaccagggagaccccttcgggctgcccggc
ttctcgcccccgcggctgccggtggccggcctgagctccccggcaccgggccacgcgggc
ctgcccgcacccgagcggctgcggctggacgcggcggcgctcagcgcgctgccgccgctg
ctcgacgtggtgcggcgccaccaggccgagctgaacccgcgcgcgccgcgcctgctgcgg
cgcctggaggacgcggcgcgccaggcccgggccctgggcgccgcggtggaggccgtgctg
gccgcgctgggcgccgagccccgcgagccgcggcccgagcccgccgccgccgccgccgcc
gccaccgccaccgccaccgccaccgacgcgggcgtcttccctgccaaggtgctggggctc
cgcgtgtgcggcctctaccgcgagtgggtgagccgaaccgagggcgacctgggccagctg
gtgcccgggggcccggcctga

DBGET integrated database retrieval system